SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725371|ref|YP_007072648.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725371|ref|YP_007072648.1|
Domain Number 1 Region: 5-145
Classification Level Classification E-value
Superfamily CheY-like 2.42e-36
Family CheY-related 0.001
Further Details:      
 
Domain Number 2 Region: 143-253
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  gi|427725371|ref|YP_007072648.1|
Domain Number - Region: 275-430
Classification Level Classification E-value
Superfamily GAF domain-like 0.000621
Family GAF domain 0.035
Further Details:      
 
Domain Number - Region: 472-679
Classification Level Classification E-value
Superfamily PP2C-like 0.00549
Family PP2C-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725371|ref|YP_007072648.1|
Sequence length 684
Comment putative PAS/PAC sensor protein [Leptolyngbya sp. PCC 7376]
Sequence
MPDSSPEVLIIDDVRLSRTFLRHVLKQANYRVSEAENGAEGIALFKERSPSLVLVDGLMP
EVDGFECCRTIRQLPGGEDIPILMVTSLEDTESVNKAFQAGASDYITKPIHPSVLLGRMR
CMLKSLHAMQELRNSEEKYRSLVTSLQEVLFQLTPDGEIIFINPIWYDIMGYSPIETIGA
QILNFIHPIEHKRNTAKIQLTSKNKDQCFRYTTRFITKQKEIRWVEVQICGNADPQTGEL
IRIAGRLYDITERALSEKYRRLEYTVNRILSHSEDIDLAIRRVLQVISGNSETPFAEYWS
LDESSQELSSSTYWHLRNDAYNDFSGSSIKFYLKDWMQSVHDITSYIEEIRAEQAVAASK
NKSSHPPFDRWRCVQQCVVSHGTQTLGLMVFWNDKKNKMDDTFSMVLEILGKQLGQYLKR
KEAEQELKKKNDLLQRELNQAARYVESLLPQPEAQESQHCSVQIDTLFQPSNALGGDVFD
YTWLDSDNLMFYVLDVAGHGVKPALLSVSILNILRRQGYSNIDFYEPEIVLTALNRLFQM
SESGDDYFSMWYGIYNHSTRVLKYASAGHPQGLLIVADEDNEEHQIKELSTDNIAVGLFS
DFPFEAASVEVPLDSHLFIYSDGVYEFFVDKHQEMFGLENWKDLILTYMQSKPATLKSLF
QQINHLNYGSTLGDDCSIMEISFG
Download sequence
Identical sequences K9Q402
gi|427725371|ref|YP_007072648.1| WP_015135552.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]