SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725475|ref|YP_007072752.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725475|ref|YP_007072752.1|
Domain Number 1 Region: 14-357
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.66e-86
Family RNB domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 558-625
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000132
Family Double-stranded RNA-binding domain (dsRBD) 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|427725475|ref|YP_007072752.1|
Domain Number - Region: 459-514
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0173
Family Double-stranded RNA-binding domain (dsRBD) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725475|ref|YP_007072752.1|
Sequence length 628
Comment exoribonuclease II [Leptolyngbya sp. PCC 7376]
Sequence
MIEQQKTPPLINTAWTKALEEAKKISLPNRLSKRPQAEGFTIDGPTSKDLDDAIWVRTAD
DAGVTILVHIADVAELVKIGSALDQAAMVRARTLYHRQGNTPMLPYALSENLLSLMPNQQ
RPTLTVEIALDQNAEIRKVDLYETQLVSCKRFSYEEADKACNDPSHPLHDQLKLCQRWAA
KLSKRRKASGAFGGMVGAGDTLLDEEGRIIDSPGGNFHSQRIIMEFMILANRAVAQWCAD
RDLPILYRNHTAKVIAPERSELIQALFTSGNVAMMRQQLQNWLNRAVYSPALVGHFALNL
TAYTHFTSPIRRLPDLINHRIIKAVLQEQASPYPSVELSNIADHIEDVNRQAEESSKAFF
KEQAKAEHSKQLAKVEGLTQLSAKEFTRVLRHGIRENNVAPLKPALNQRLSDGSLAIHDL
FLLLLENQDNALQEIALEALKSRVCDAPSIMSIANNILPQWEEVSFIEQKSKKNFVCWAV
VTVDGQSMTSRLPGAGKKKQLAKHHGCFAWLNAHVSGKLVEPEQRQLPSGAEPQPNLIKD
DSELKKHPSLTTHLKDGQNFIGLLGELCQSNQWALPSYSMTEVDDGFLCTCEGKAGDIPY
KGEGTGTRKKQAKKLAAKEALRFLQTAL
Download sequence
Identical sequences K9Q3J2
gi|427725475|ref|YP_007072752.1| WP_015135653.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]