SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725487|ref|YP_007072764.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725487|ref|YP_007072764.1|
Domain Number 1 Region: 3675-3762
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000345
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 459-857
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000154
Family Pectin methylesterase 0.043
Further Details:      
 
Weak hits

Sequence:  gi|427725487|ref|YP_007072764.1|
Domain Number - Region: 2232-2317
Classification Level Classification E-value
Superfamily E set domains 0.0606
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427725487|ref|YP_007072764.1|
Sequence length 4154
Comment RHS repeat-associated core domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MPQRIWDNVVGGFWDIADNWSDDIVPNVGDEVLIDLEGLIETTHRTGNTFISSLISEASL
AISGGSLTVEGNLEINAPLRILSGSLVLNGSGSLGGFELSGGLLSGAGNIGVESNSIWTG
GTYNGTGLALLANATLEATGGNKDFSGGIIETQGTTLWDAGQIRASNSATWNNTSTAVFD
IQGDLFFDHLNSSGAVPVINNAGILRKSAGNSTATIEAQLNNSGVIDVQSGLLRPTGGIT
LNDGSQITGDGKVLVNANTLTLDGIISSSGTLEFSSGSLIGDAELDNLTWTGGTYNSTGL
KLIEGGTLTLAGGTKTFAGILETNGQTNWQSGTIRTNNTPATWNNTATGVLDIQDGLTFE
NASTGDTVVPIINNDGTLRKSGSAGTTTIQAQLNNSGVIDVQVGVLNSTFGVTLNNGSQI
TGNGKVLVNANTLTLDGTISSSGTLEFSSGSLIGDAELDNLTWTGGTYNSTGLKLIEGGT
LTLAGGTKTFAGILETNGQTNWQSGTIRTNNTPATWNNTATGVLDIQDGLTFENASTGDT
VVPIINNAGTLRKSGGAGTAAIQAQLNNSGIIDIQSGILNPTFGVTLNNGSQITGDGKVL
VNANTLTLDGIISSSGTLEFSGGSLIGDAELDNLTWTGGTYNSTGLKLIEGGTLKATGGN
KNFDGGILETQGTTIWDSGEIQAWNGATWNNTSTAVFDIQGDLYLEHYFDSGAVPVINNA
GTLRKSAGNGTATIEAQVNNIGGVDVQSGTLSLLGGFTQSAGITRLAGGSLSASSPLDIQ
GGSLEGFGLLNASISSSGEINPGVGIGTLNLVGNYTQSATGTINFEIGGREVTAVDRLNI
DGNANFDGTLNISFIDGFNPLLGETFTVATFDSFTGDFANITVEGLIGDAVDYEIETLFE
NNQLILSITDPDFDGPDLQVNSVTSALGTGTLGDDIELSWTVSNQGDVPTLAGWSDRLYL
STDTALSADDRLLFTQPIDNFTVLDPGQDYTQNATVTLPLDTSTAPGNYYLLVETDGLGD
RPETNEVNNVTASDAVIDLTLPTDLPDVVVSAIVVPTETVAGQAVQIKWTLTNQGGRPAS
GTWTDTVYASSDDAIGQDISLASFEFNGSIGAGESLERVQTITIPSNIQSNQHIVVTTDA
NNQLFEQSDANNTAISDQAITVLQPTIPNLQISSVTPPAQAFSNQSTVVNWTVTNAGTGA
AGEWYDQVWLSLEPRTELGPDQLPIPTDIFLGQIQNAGYLEPGQSYSSSLEVTLPEGLDG
NYYFVVYSNIEEWSAGRHHGLGRLLESDRTDNLGLGASTQVNLTPPPDLQVLDVQASTQG
FSGETTSITWTVSNEGIGTTLRHNGLGFFIQSTLTESFGFGDAWDPLDISWQDKLYLSAD
QELDSEDILLGTFSYDGPLTSGESYTKTQNVTLPIGISGNFFVIAETDVLQPNPGLYGVS
FGSSSLRDAVFEGGFEDNNQNHTVTPIQVNLTPPPDLGVEILAAPTGATASRSLVINYRV
TNDGSTTTPNSSWQDAFYLSSTPDFDPDTALKLREVTHSGRLDPETTYENSVSLTLPNEV
SGEYFIFVVTDSNNAVFELDDVAEGSNADVSPNLVSQTITITSQPADLVISDANTPATAE
AGQATRVEWTVTNEGTGDTSVTSWVDRVIISDNDILGDEDDQILATFNQTGLLDVGESYT
RNELVTFPNTFAGDKYLFVVTDARNNVYEAAQEDNNASDGLPVTLPELSESLANLEVTAV
NSPTVARGAEFLTISWTVENTGVGSTDSTVWYDNVYLSSDPTLDKDNAILLGEIRHTNPL
ESGQEYTAQQTFIVPPNAEGDFYVFVEADSRNQVTEPTEGGNIASTAEATRVVAFQTADP
ELPPVETIDPDVVELPVDLSVVAVEAPSDGNSGQPLEISWTVQNNGEAIGSRTWYDAVYL
SQDQVFDPNTDNYLGAVERTGLGAGESYQVTKSFDVSVGLSGPLYAFVVTDSTERLNDTD
RTNNVTLDSTAIQVLPIPPDDYDLAVGTIAVPATSISGEATTISYTVTNEGTATISGTWF
DTVYLSADNQWDIGDAVLGQIQVSETLGNGESYAQDLTVTLPGVLPGDYHVIVRSDIRNT
FAEVDETNNVAVSAEQITTDISALTLGNTVESTLADGQSTYYRVDVAAGEILKVELDSDS
ASATNTLAIRYGDVPTRSEFDFSETNPFGSDVELVFPNTKAGTYYIQAFGTQVPEGSAGF
SLTADVLDFSLSDIGSDSGSNKGQVTLTLKGAKFTPDTIAKVIADNGTEREATNLIWKDE
TEIWATFDLQGLETGLYDVVVADGNVVTSLDDSFTVNDGPVGNLQVQVISPEAVRPGQSG
TVQVIYTNTGETDITAPVLAIDAYYAELAEQRVSSFQTSDGRFFTSQIALSDEDFTKQPI
QFLGINSDGPAGILAPGDSGNVSFAFRHVLSDETIPQELVPTIDLGEGSGGPVSSPPIAF
FASALEEDLAINWLDFKDAFKPLGYSDAAWDVVYDNFVAEIGDDTTSFQELVAENATYLA
ALGESTNDIGELLTAELQQVSQYQALAQQLRIGSLGQGQSFIGDVQVLEDEDGNVVIDYN
GVLRLFEQQTDGSYQGQPGDNGVLTQVGSGYQLRELDGTITTFQGDGRIVSVQDPNNNQI
TFVRDANQNNRLIRLAFSTGDFIDYTYNAFGRIEIATDHAGVQTTFGYDPTGQFLSQVTT
PAGTISYEYENGLLSKFTDATGVSVEFEYDSRGRIISQSLTNGESTLNYVYNSTGGITVT
DENGVETELILNAQGQVSQINDPLGNTLELQYDARGNLIGLQGPDSATLDYGYDAFGNLI
RQTNPLGNDIQFSYDSAFNNLASVTDENGNPVQYSYDDRGNLEAITYADGSVEKFVSDAQ
GNIERYTNRRNIPIDFEHNDRGQITRIDFQDGDYIEYQYNDLGQLTVAAESRDGIDSSIN
FTYDSETNFLERIDYPNGRFLAYEFDGAGRRTRLEDQDGNVVNYQYDDAGRLDQLRDVTD
SLIVQYQYDALGRLEREDKGNGTYTSYQYDDAGRLVKLIHYAPDGSTNSSFEYIYNDLGL
QTGVTNIDGNWSYTYDALGQLSGAVFESTNPAIENQNITYEYDASGNRRRTIVNGETTNY
AANNLNQYTSAGTVVYDYDADGNLISKVDDDGQSTFNYDDFNRLVSIEEPGGVFTEYVYD
ALGNRVASISDGERIDYLVDPIGLLQLPTFQSDNPLFNLVDLYSPLSSPRLSNVVGEYYG
DENNAVQYVHGLGLESQSNNSGVVSFYNFNAIGSTAQLTDSSGEILNRYSYSPFGIRLTD
EEQIANPFEFIGQYGVMESTSNLDFMRARFYDSQLGRFVSNDPRGFEGGSPNLYKYANNS
PANYSDPEGEFVITLSVGTVLAVSAGIGFIYGVQSSPEEYENLGGFQDARNGALGIGGLT
VALQTLGAAFPALEVGYVGGLYFGLAPAAPLFAGIGGALLLGNLLGKGSLYIASNFDRLW
DTWAYRYLSGAFSNLLSGIDPNDIIGPSGIGDDNWLTAETTLPYIIRFENLPEATGAAQE
VVITHPLDPDLDWRTFRLGSFGWGDFTFEIPENRSFYQERIDFTEEYGFLVDVVARIDVI
EGVATWTITTIDPETGQKTNDAFVGFLPPNDEEAIGEGFVTYTIQVDDDVETGAVIDAQA
TIVFDTEAPIDTPPIFNTIDAGAPSSTIDVLPTTSDVPEFLVSWTGTDDDNGSGIAGYTV
YVSENGGEYIPWLEDTQLTEATYLGELGKTYQFYVVAIDNAGNRQQGPEEAQASVFVRSS
NELPVLSVNESLDVNEDMTATITADELQVTDADNTPEQLTFTVTDLPNHGDLLLNNVALT
LNGTFTQDDIDNDLLSYINNGTANTIDSFNFTVFDGVDGNIGTNTFAINIIPANNAPEVT
NPLADLTIEEGAENSVINLSDVFSDENGDEITFSIVSNSNSDLVIATIDNGQLILDYQDN
QTGSAEITIAGDDGKGGIVEDVFEIDIPEFDPLTGMTTEVYRFYRKDAGSHLYTSDPNEI
AVFRANPGIFTEEAGVATNGAIFLAGNAPSDGLKAVRRFYNKQTNGHFFTSDTNEIAAVQ
ANQVAAGVFRDEGVAFYALEDSIPDLATDVYRFSNINTGAHFFTNSIIERDIVIANQVAA
GFFRFEGVGWEAIA
Download sequence
Identical sequences K9Q2I3
gi|427725487|ref|YP_007072764.1| WP_015135665.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]