SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725489|ref|YP_007072766.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725489|ref|YP_007072766.1|
Domain Number 1 Region: 1240-1350
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000314
Family Collagen-binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 756-857
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000248
Family Collagen-binding domain 0.0044
Further Details:      
 
Domain Number 3 Region: 998-1096
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000157
Family Collagen-binding domain 0.0073
Further Details:      
 
Domain Number 4 Region: 7-111
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000314
Family Collagen-binding domain 0.0052
Further Details:      
 
Domain Number 5 Region: 873-982
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000314
Family Collagen-binding domain 0.01
Further Details:      
 
Domain Number 6 Region: 1144-1219
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000131
Family Collagen-binding domain 0.0061
Further Details:      
 
Domain Number 7 Region: 405-485
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000968
Family Collagen-binding domain 0.0073
Further Details:      
 
Domain Number 8 Region: 146-236
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000262
Family Collagen-binding domain 0.0086
Further Details:      
 
Domain Number 9 Region: 1605-1699
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000209
Family Collagen-binding domain 0.0072
Further Details:      
 
Domain Number 10 Region: 277-360
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000275
Family Collagen-binding domain 0.01
Further Details:      
 
Domain Number 11 Region: 1389-1469
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000288
Family Collagen-binding domain 0.0083
Further Details:      
 
Domain Number 12 Region: 644-741
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000602
Family Collagen-binding domain 0.0042
Further Details:      
 
Domain Number 13 Region: 531-605
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000366
Family Collagen-binding domain 0.016
Further Details:      
 
Domain Number 14 Region: 2056-2259
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000523
Family Tricorn protease N-terminal domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|427725489|ref|YP_007072766.1|
Domain Number - Region: 3182-3263
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00184
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number - Region: 1713-1798
Classification Level Classification E-value
Superfamily E set domains 0.00218
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number - Region: 1485-1580
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0392
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725489|ref|YP_007072766.1|
Sequence length 3427
Comment RHS repeat-associated core domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MQDIAGNTLNTALDIHILSSIPQVFEDEVGGEDPRDYYRFELSENSAVTLLVSDLSQDVT
LFLRNSDGSREISRSANAGTVNEQIELNLKPDSYFFYVSRTGSGEATPYRLTAQATSLGP
TPIDNAGEILDKAKDLGVLNSDEISINDYIGNFAGLVRDAIDYYRFELIENSEVTLTLGG
LSENVSFSLLNADISEELTRAFNPDIEDKNITRNLKAGIYYLRVNHSGVGTPYQLEASAI
SLGPTPVDTAGENLAKARSLGVLSETSITVDEYVGNFNSLTPDSNDHYTFKLAENSTVTL
KVSGLTENASLFLYNGDRTQELNRSVNAESADELIIRNLAAGRYTIVVDRNNNVGTPYQL
EASAVSLGPMPLDTAGETLSRARNLGALSENVTTVNEFVGDFNSLNSDPDDYFTFELTEN
STVDLKLSGLGETASLLLYNVDQSQLLTNSSNPGTDDELIVRNLAPGTYTLRVNKGTSAG
TTYKLEASAISLGPTPTDGAGESLDKARDIGVLSEDVISIEDFLGGFNGITFDVFDDYRF
ELTENSAVSLRAKGLDGRSFFSLRNADGSRTIEQSNPPVGTDGIIERNLKAGTYYLRLFN
NTSNNPNGITYTLEASATSLGPIPTDEAGEQLDQAKNLRVLDSNSVVVNDFIGDFNGLSR
DSMDYYRFELTESSQVNVKLSGLSESADILVVNRNSTKTLADSRSDQSGTDDKVLTLDLL
PEVYHIYISRNASTGGTTYQLETSASPVEITEPGPFDGATDIGQLGDSIVTFSDAIDRNN
FVDYYRFELAENSEVDITLSGLEASAVFSLYNQDGGQAIASSEESVDRNINRNLRSGTYY
IEIRSGFFGGATSYQLEAIATSLGPIPIDAAGNTFDKAKDLGTLTETSIISEDFIGYFNG
ISQDFNDNYQFNLAENSTVNFTLSELSENASLELYNVDGSQLLRQSNNAGNADEVISRNL
RAGNYFLKVSSNTTGTTYRLELSAISLGPLPVDGAGETFEKATDLGVLSSVGLTIEDYIG
NFETLSLDADDYYRFELIENSAVNLTLSGLSSAASLYLHNADGSTVLRQSNNPGSDDEEI
NRNLKAGSYYVRVTGNETAYRLEASVISLGATPQDLAGEEIATARDLGVLSEAEASISDY
IGNFNTLFNDSLDYYRFEISENSDVTLTLEGLSENASLDLYNADGSRVLAESRNAGSADE
VITRNLTAGAYYLRVSGVGTPYELKASATSLGPIPTDSADNTFDKAKDLGIVGAEAVTLN
DFIGDFSGLSLDDQDYYKFELAENSALNLKLNGLNENATLYLFNGDNSQQLAISNSGDNG
DRVIERNLRAGIYSIRVVSGSIGTPYQLEVSAASLGPIPVDGAGETFDKPRELGVLGEEA
IIIDDYAGSFNGLSFDTGDYYRFQLSENSSIEIDLTNLVEQAGVRLYNSDGSRVIESAIA
TADSNGKITQNLRAGSYFLNVARNSETGTPYQIEVKASSLGVYQDNAGNTLAAAKDIGVL
EDSRTFEDFIGNFFDLIQDGIDLYKFEFKETSTLSLALNKFTAETNTSIQLLDEQGNFIE
STNGNTLNAALGAGIYYFQILPGFFEGTRYAITATGAPILDLAGNTLGQARDIGNLDGSR
TFTDYIGDLDRNDFYQFELESDSNVNLGISPELLGESVSIRLLDRQGNLVDSSNDTIATD
LEAGSYYAQVIGGDTYYDVSFSAIPEAAGPFQIEAVTPVEGSNVGQTTITVQGSQFTSAA
QVSIIDATGTEFVADTVNIQSESSLTATFNLVGLAEGAYDVKVVDEAGIATANDLFNVIT
GTPGKLDVFISAPSALRPWSTGEVVVTYRNSGDSDITAPLLTLNAEGANFEEDGEYSDGT
VQFLAINKEGDAGVLPPGATGTYTVKFQPNPGVNNIDFTVNSLATGETVDWNAIEESSRP
ENIPVETWDVIFQNFTDEVGDLAGQYEKVLAENASRLSELGEYTGDVSRLLSFELQQGNS
QAIFERFTEGSFGRGWNNPWDVTATANGEGDVVVANGGSLRFFERQANGSYRGDDGDAAT
LTQEGETLQLREEDGTVIAFLDNGKLAAITDTNGNEVVAGYSGDNLTTLTYSNGDVVRFA
YNAAGKVREVTDPFGQKTTYTYDAANERLLSVTDESGTVSYTYETEGAKANAIKSITFPD
GTQTLYEYDDQGRVTKESRNGGEETVTYTYDSAGKVTVTDAEGNAAQLFQNADGQVSRTV
DALGRITEFRYDDAGNLTRIVAPNGDVSTFNYDSRGNLLSSTDPLGQQVSFTYDSEFNQI
QTVRDQRGNRINYSYDDAGNLDGIVYAVGTSETYQYNADGEVTTSINRRGQAINYSYDER
GLLTKKAFADGTEATFEYDERGNLTKAVDSDSSVTYAYDSANRLTKVTYGTGRFLEFDYD
AGGRRSRMVDQDGFTTNYLYDEVGRLKQLTDEDDANVITYSYDEIGRLAREDNGNGTYTT
YGYDAAGQLLSIVNYQPDGDINSRYDYTYDELGQRTSMTTLEGKTNYGYDATGQLTSVEL
PNGREIVYEYDAAGNRISVTDDGVRTNYATNNLNQYTTVGDAVYTYDTDGNLISKVDGDD
TWTYSYDIENRLVGVTTPDGTWAHEYDALGNRIASIEGGDRTEYLLDPTSLVDVVGEYSS
TNFISYTYGIGLVNQVGIDDIAKYYDSDAIGSIVGLSDSTGGYVNKYSYLPFGRTLSTTE
AIANSFEYVGQFGVMHESNSISFMRARFYSFDDGRFINLDPVGINGGVNLYAYTSNNPIL
FTDPLGLRACISSDQRLVMQSTGAGLTAVAGAAIGAGIGGLVGAGIGFAINPALSPIGGG
LGIGIGGIIGGGVGSGVGSAVFEKIGQAVDTYNQGCDDHDPTPPENSNPTTPSDLSDPGT
PFGPNNPNTPFGPNNPNTPFGPNNPNTPFGPNNPNTPFGPNNPNTPPGSDNFNPNNPNSP
FNPNNPNSPFNPNNPNSPFNPNNPNSPFNPSGESSTSVRRSSDPNDILGPAGFGPLNYIT
PDQTLPYTIRFENQASATAPAVFVTITQTLDADLDLSTFELGDFGFGDIYIDVPEGFQNY
SQRLDLRDTLGDYVDFEASLNKETGEVLWTLTTIDDETGNIPDAVDAGFLPPNNETRDGE
GFVSYRINAKPDLPTGTRLDAEASIVFDTNEAIETPPIFNTLDVGTPSSQVTAFSGTVFP
IFDVSWSGTDDGSGIAHYDIYVSVDDGDYELWLDDTTDTTATYTGEAGRTYRFYSVAKDN
VGYTEDAPITADATTTPIDIPEVDPLTGMTTEVYRFYRKDAGSHLYTSDPNEIAVFRANP
GIFTEEAGPATNGAIFLAGNAPSDRLKAVRRFYNKQTNGHFFTSDTNEIAAVQANQVAAG
FFRDEGIAFYALEDSIPDLATDVYRFSNIDTGAHFFTNSIIERDIVIANQVAEGFFRFEG
VGWEAIA
Download sequence
Identical sequences K9Q5A0
WP_015135667.1.56710 gi|427725489|ref|YP_007072766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]