SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725572|ref|YP_007072849.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725572|ref|YP_007072849.1|
Domain Number 1 Region: 299-491
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.92e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000566
Further Details:      
 
Domain Number 2 Region: 774-995
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.01e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.0001
Further Details:      
 
Domain Number 3 Region: 42-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.75e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0017
Further Details:      
 
Domain Number 4 Region: 140-183,269-322
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000157
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0096
Further Details:      
 
Domain Number 5 Region: 686-775
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000288
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0054
Further Details:      
 
Domain Number 6 Region: 184-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000706
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0083
Further Details:      
 
Domain Number 7 Region: 548-633
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000243
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725572|ref|YP_007072849.1|
Sequence length 1016
Comment acriflavin resistance protein [Leptolyngbya sp. PCC 7376]
Sequence
MSFHVSAWSIKNPVPTLMAFIILSIVGLYSFFNLGIDNTPNVDVSAVIINVSQPGAAPEE
IETEITKKIEDAVASLADIDQLTSTVTDGSSQTIINFEIGTDTDQATNDVRNAIAEIRTS
LPQDITDPVVRELEFAGGSVMTYSFSSEKRSVEELSDLIDRKVGRELVNVKGVAEIRRLG
GLDREIRVDLDPQLLQGLGISASQVNDQIARFNLNRPGGRVELGGSEQNVRTLGSAKNIQ
ELQQYPITLPNGDTVALQALGRVEDSFREPRVAATLDDAPVVAFSVWRSPGSTTFGVDQG
IRKAIAKLEKTLPDDLKFQLIFTRADEIKASYDGTVLALVAGCILTVMTVGIFLKDWRAT
LITATALPLSIIPTFFVMRSLDYTLNGMTLLALALAIGNLVDDAICMIENIDQHLQMGKR
PFQAAIDGAMEIGLAVVATTATIVAVFLPVAFMGGVPGQFFQPFGVTVAVSTMFSTLVAT
TMTPMLSAYLLKSKLDGFNADNQPGTYRNILTWALRHRITTLLIAFAFFVGSLQLVPFIP
KGLFSTSDTGISVVSFDLPPGSTLDDSKRVMGFVGDRLRENPAVKSVLATADNINSGLIY
VNLIDKKERISQREFEQGMRTEFRKIPGARVAFRSNSAGGTSKDLTIILKSEDATTLVET
AQTLEQQMASISGLVEIASSASLVKPELIIKPNPQRAADLGVSVAAISQTASLALIGDQD
FNLPKFNLSDRQIPIRVQLAPEKRQDIDTLKNLLVPSSTGEMVPLAAVADLRLGSGSAQI
DRFNRFRQVEVGANLQGVALGDAFAQVNALPVMSPLPPAVTLEPSGDAEIMRDIFSRFLT
ALSAAIICIYAILVLLYNNFLYPLGILSALPLSIGGALIGLLITQKELGLFALIGIVLLM
GLVTKNAILLVDFTLAGVQEGKSLRQSLLEAGVSRLRPICMTSISTIAGMMPIALELGAD
GATRSPMAIAVIGGFSTSTVLTLVVVPVLFTYIYNLTQFLIRPFRASSHMPQETQA
Download sequence
Identical sequences K9Q2Q4
gi|427725572|ref|YP_007072849.1| WP_015135744.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]