SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725664|ref|YP_007072941.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725664|ref|YP_007072941.1|
Domain Number 1 Region: 287-480
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000837
Family PP2C-like 0.019
Further Details:      
 
Domain Number 2 Region: 56-210
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000414
Family GAF domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725664|ref|YP_007072941.1|
Sequence length 488
Comment serine phosphatase [Leptolyngbya sp. PCC 7376]
Sequence
MTSTSSIQPPANRSGSQHQESRLVALSHQPKAEVVSADPIQEDVEFLKAQIAKLSREQTK
IQDLLSSLGFALRSFNNLNQFLELTPLISARVSDADGGVLLTFTKEGRIRLEAIYCGQGE
GIDVIKKTFEKLESLGSGNTEALELDELDDWLQSALENVAILHSTSILVKNIERGRLFIF
STSENYIWDITRRKLVQLVADQTAVAIANNDLTRKLRQKEKQDRELEIASEIQNHLLPRE
CPRISGLALAAECRNAYRVGGDYYDFIPSNYDRVRHQDDPKLVQCVPWSIVIGDVMGKGV
PAGLIMTMTRGMLRAEVLNRHTPAQVLSHLNRVMYPDLDNSHRFVTLFYSEYDPVSRKLS
FCNAAHHPPLLWRAQTDTIEQLDTWGMLIGLDMDSKYEEGEVTLEPGDIILYYTDGFTDA
VNAHGDRFDEANLYESFQTACRTHNNPNEIVDALFKKVSQFTYPKIRNSDDMTLVVVQVQ
SETVKPCQ
Download sequence
Identical sequences K9Q5Q2
gi|427725664|ref|YP_007072941.1| WP_015135830.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]