SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725889|ref|YP_007073166.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725889|ref|YP_007073166.1|
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-22
Family cAMP-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 204-419
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000131
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427725889|ref|YP_007073166.1|
Sequence length 430
Comment cyclic nucleotide-binding protein [Leptolyngbya sp. PCC 7376]
Sequence
MSDSLPNDTVLSFGESHDDWEAIAGCELFQGVQPVLLKDLLQRCSIQSFPAGSTLTEPGQ
ENHTLYILLGGHLMVYLAETEDAVLNPEMGFQIPVGECIGEMSIIENKPVSAYVVAATEC
RLLSIPESLFWDELMSWPEVVKSMLTGLSSRMRRLDKVAIKTLEERLRFEQIERDLKAAA
QIQSNILPQEKPLLAQYHQVDVAASIEPAREVGGDFFDTFPIDEHTVGLAIGDVSGKGIP
AALFMIRAVTILRASIARLNIQDENLASIFSAVNRQLCESNPNCLFVTIFLGTLDVRTGK
LTYVHGGHNRPFLKRVNEGSAMIPIPDGMLLGIFAEAEYKLAELTLGKGDLLVMYTDGVT
EARDRDGQFFMEERVTSILDQLPATISSTDIVSVLGNRVKNFTEQMPQSDDITIMTLRYK
GEPPEVSTRD
Download sequence
Identical sequences K9Q6E4
WP_015136048.1.56710 gi|427725889|ref|YP_007073166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]