SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725946|ref|YP_007073223.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725946|ref|YP_007073223.1|
Domain Number 1 Region: 238-748
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.66e-148
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 33-235
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.83e-54
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725946|ref|YP_007073223.1|
Sequence length 764
Comment ribonucleoside-diphosphate reductase subunit alpha [Leptolyngbya sp. PCC 7376]
Sequence
MLKTTQPYTSESVTHSPQPSTPAKEATIYVVKRNGKRSPLDVSRIRDVVEWACQGLDANT
IELEAGLKTRLKDGVTTREIQENLIQCALEMCSPEEPDWRYVAGRLHIWSLWKDTLVERG
YQYGNYAQLVTDKVAEGAYDDRLLQYSATELEEANSWLKSDWDMDYDYAGAVLLTKRYLL
DHELPQEAFLTCALLLALPEKPENRLKWAKKFYEAIATRKVSLATPILANLRVPNGSLSS
CFIIAMEDNLESIFREITNAARISKNGGGVGCNVSRIRATGSKVMGKENASGGVIPWIKL
LNDTAIAVNQGGRRAGAITVSLDVWHLDVPEFLEMQTENGDQRRKAYDVFPQIVATDEFM
RRVENEESWTLVDPFEVQQKLGIELAELWGEKFDAAYRQIEASLDKEIKLYKRIDARHLF
KEIMRSQIETGMPYVAFKDTINRANPNQHEGYIPGVNLCVESFSNVVPGKFAHTCNLDSL
NLANISDEELGEVCEIAVRLLDNTIEITNTPFEDSSIHNKRYRTIGVGAMGLADWLAKRK
LRYSNIDEIDRLFEDIGYYCTRTSVDLAKERGAYAAFEGSEWSKGNLIGAKPIEWYRENT
YKTDRWEALSVDVKEYGIRNSHITAIAPNTSSSLVQGCTASILPAYSKFFYDKWAKGTVP
IAPPYIADSFWFYQENKSLDQKTVVKAVATMQKWIDTGISMELIFNLNQGVYFADEPERS
LKAKDIFDTLVMAWKEGCKAIYYIRTVQKDDFKEGSDGCVACAN
Download sequence
Identical sequences K9Q5M2
WP_015136103.1.56710 gi|427725946|ref|YP_007073223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]