SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725967|ref|YP_007073244.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725967|ref|YP_007073244.1|
Domain Number 1 Region: 1-267
Classification Level Classification E-value
Superfamily Folate-binding domain 7.85e-58
Family Aminomethyltransferase folate-binding domain 0.0006
Further Details:      
 
Weak hits

Sequence:  gi|427725967|ref|YP_007073244.1|
Domain Number - Region: 275-345
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000894
Family Aminomethyltransferase beta-barrel domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725967|ref|YP_007073244.1|
Sequence length 348
Comment folate-binding protein YgfZ [Leptolyngbya sp. PCC 7376]
Sequence
MTPLLTYHQQQGATLNDAGNAVLSFGADDQITAALKTGCVVGDRSHWGLIKFTGADRQRY
LHNQSTNQIQQLQPGQSCDTVLVNSTARTIDLATVHIFKDELWVSVSPSKTEFLMEWFDR
FLFPMDKVEISDITGQFSILTLYGSESRKTLEQLTETPLQIFPDKGHQAIAIGEAEIICA
TGTDLGFEGFTLFVPIENAVELWQKIIDLGAVPMGETAWEKQRIHQGRPAPDTELADDYN
PLEAGLWHCISFDKGCYIGQETIARLNTYKGVKQRLFGLKLAEAVEPGTKLTVDGERAGI
VTSVDAENKFAIGYVRTKSGDVGDVVTAGDVMAEVVALPYVSHEYPEL
Download sequence
Identical sequences K9Q3X1
gi|427725967|ref|YP_007073244.1| WP_015136124.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]