SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725973|ref|YP_007073250.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725973|ref|YP_007073250.1|
Domain Number 1 Region: 259-509
Classification Level Classification E-value
Superfamily PP2C-like 3.14e-43
Family PP2C-like 0.0000853
Further Details:      
 
Weak hits

Sequence:  gi|427725973|ref|YP_007073250.1|
Domain Number - Region: 578-684
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 0.00224
Family Tetrapyrrole methylase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725973|ref|YP_007073250.1|
Sequence length 755
Comment protein serine/threonine phosphatase [Leptolyngbya sp. PCC 7376]
Sequence
MDISKVTISCTKSDCSGRSPLHHSHCNICQTPVLKRYLHVLAAPEDLLAPQTFLADRYLV
TDIPNIVLDTQPHYLPVVTDNLPAEIETYLKLSTHLLHCPKVFGLTQKENGHWLLEYPSV
TLTAEGLPQYPALFLSIREAWPSAEPLQQLNWLGQMAGMLPTFLTEGVAGTFDDLSLLGV
NGGVVQIRQLLFDRNRKLDFQELAQAWQELLGTADKSIEKFCRRLYKELIQGKINKPQQL
QNILTAGIEELGRSHYKYKYSLYTQTDSGPTRDHNEDACFPESGKVHSNFPLAIVCDGIG
GHDKGEVASAIAISTLAEQLLIEDPSTLNPAGITEAVYAANDAITACNDEENRRERERMG
TTVVLALTQKPNIHLCHVGDSRIYRVTSESCHQVTYDDDLGSREVRLGYALYQDVLSYPS
AGALVQALGMNPSQSLHPTTQTFAVDCDTVYLLCSDGLSDYGKVEQYWQSEIVPLLSGNK
AINDVGENLIEIANTKNGHDNSTIALLHIQLKRQKAVPISFPEDLEGILNLPVTSQQQNA
PYETSNKSNNAPPPQTQPSVAPRRKQKANWLLLCIGLLGIGGIGLLSYEMWRRLQSTDII
VTPPEPDTPIIEPKPISEEPVETPTIAIPDPDELEPEEETADALTKNQIVRLQSTAPVIA
TYTPQAIADTEAPTVWIPGGSVAQIKQVNTDGNLLLEVCLVGEQTPPDTSTKILAKGNRG
WSQPDQVETQQDLNFVVTSDIETLCQTQEAPVLAN
Download sequence
Identical sequences K9Q5K7
WP_015136130.1.56710 gi|427725973|ref|YP_007073250.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]