SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427726037|ref|YP_007073314.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427726037|ref|YP_007073314.1|
Domain Number 1 Region: 30-491
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.57e-174
Family Type II DNA topoisomerase 0.000000000286
Further Details:      
 
Domain Number 2 Region: 502-712,739-851
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 6.54e-97
Family GyrA/ParC C-terminal domain-like 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427726037|ref|YP_007073314.1|
Sequence length 871
Comment DNA gyrase subunit A [Leptolyngbya sp. PCC 7376]
Sequence
MTSPQERIIPTDLSNEMSRSYLEYAMSVIVGRALPDARDGLKPVHRRILYAMYELGLTPE
RPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRDPLINGHGNFGSIDNDPPAAM
RYTESRLQSLTTNALLRDIESETVDFADNFDGSQQEPVVLPARVPQLLVNGSSGIAVGMA
TNIPPHNLGEIIDGATALIHNPEITIQELMQFIPAPDFPTGAQILGRSGIKDAYLTGRGS
ITMRGVAEVEMLRQNGREKEAIIVTELPYQTNKAGLIERIADMVNDKRLDGISDIRDESD
RQGMRIVIELKRDAYAQVVLNNLYKHTPLQNNFGANMLALVNGEPQLLNLKQFLTVFLDF
RVEVITRRTQYELRKARERDHILQGLLIALSNLDAVIALIRRAADSATARTELMEGYELS
QPQADAILQMQLRRLTALEADKIQAEHEDLQLKITDLEDILARRERVDAIIEDELTEIKT
IHQSDRRTEIVFDAGDLQDIDLIANERSAILLTEQGYIKRMPVATFDAQNRATRGKAAAK
MKEDDGIDHFLTCCDHDHVLFFTDRGVVYSLHAYQIPESSRTARGLPAIQLLPIPKEEKI
TSMIRVSEFTEDEYLVMLTQNGYIKKTTLSAFARIRSNGLIAISLEDGDQLNWVRLARQE
DSIIVASSEGMAIHFQADSKQLRPLGRSTRGVRAMKLKSDDDMLVSMDIVSAQITAAIAA
SDEAEEDEDNEDILEDVDNGPWVVAVTTKGFGKRVQVGRFRLQNRAGVGLRAIKFKSKGD
RLASLRIVHSGNELMLVTSRGIMIRQAVESISLQSRNATGVRVQRLDKEDAIVAVALVPE
AADEDVEDTQDEHTIDGDSVELEMTESTEEE
Download sequence
Identical sequences K9Q432
gi|427726037|ref|YP_007073314.1| WP_015136192.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]