SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427726085|ref|YP_007073362.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427726085|ref|YP_007073362.1|
Domain Number 1 Region: 104-314
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.83e-57
Family BC ATP-binding domain-like 0.00000765
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.41e-35
Family BC N-terminal domain-like 0.00009
Further Details:      
 
Domain Number 3 Region: 325-418
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.19e-31
Family BC C-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427726085|ref|YP_007073362.1|
Sequence length 421
Comment phosphoribosylamine--glycine ligase [Leptolyngbya sp. PCC 7376]
Sequence
MKILVIGSGGREHAIAWKLLQSPNVDVVVCAPGNGGTATLENCENVAIAVDDFEGIAKIC
TDQTIDFVVVGPEVPLAMGLADFLAEKSIPVFGPKKEGAIIEASKAWAKALMDEAGVPTA
ASGTFTDPQAAKDYIQAQGAPIVVKADSLAAGKGVIVAETTDEAIAAVDKLWEQGYDTLV
VEEFLIGQEVSVLALCDGKSIRPLLPSQDHKQIGEGDTGENTGGMGVYAPTPLAPPDVMA
KVQVDVLEATLKTLQARGIDYRGILYAGLMISPDGVIKVLEFNCRFGDPETQAVLPLLET
PLDKVLLACVNQTLAELPPLTWYDGSAVCVVAASAGYPGAYEKGKVITGLEAAESLKATI
FHAGTKLEGEKLVTNGGRVLGVTCLGKTFDEAITNVYQAIPNVNFEGIYYRSDIGHRLKK
A
Download sequence
Identical sequences K9Q585
WP_015136240.1.56710 gi|427726085|ref|YP_007073362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]