SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427726107|ref|YP_007073384.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427726107|ref|YP_007073384.1|
Domain Number 1 Region: 17-136
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 8.63e-33
Family N-utilization substance G protein NusG, N-terminal domain 0.0000904
Further Details:      
 
Domain Number 2 Region: 128-199
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.74e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427726107|ref|YP_007073384.1|
Sequence length 201
Comment transcription antitermination protein nusG [Leptolyngbya sp. PCC 7376]
Sequence
MEQHSEEQQEVQAGIKPRWYAVQVASGCEKRVKANLEQRVHTLDVADRILQVQIPQTPTV
KIRKDGSRQHSEEKVFPGYVLIQMALDDEAWQVVKNTPHVINFVGAEQKRSTGRGRGHVK
PVPLSRAEVERIFKRAQVAEPTVKIDMAVGDKIMVLSGPFKDFEGEVVEVSPERSKLKAL
LSIFGRDTPVELEFNQVEKQG
Download sequence
Identical sequences K9Q499
WP_015136262.1.56710 gi|427726107|ref|YP_007073384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]