SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427726137|ref|YP_007073414.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427726137|ref|YP_007073414.1|
Domain Number 1 Region: 111-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 6.93e-39
Family Ribosomal protein S3 C-terminal domain 0.000016
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.54e-35
Family Prokaryotic type KH domain (KH-domain type II) 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427726137|ref|YP_007073414.1|
Sequence length 240
Comment 30S ribosomal protein S3 [Leptolyngbya sp. PCC 7376]
Sequence
MGQKIHPVGFRLGITKEHLSRWYADSKQYPELLQEDYKIRQYVDANLNNAGISKVLIERK
ADQVDLEIHTARPGVVVGRGGSGIEALRTGLQQALGDQRQIRINVVEVARVDADAALIAE
YIVQQLERRVSFRRVVRQAIQRAQRAEVQGIKIQVSGRLNGAEIARTEWVREGRVPLHTL
RADIDYSYKTAQTIYGILGIKVWIFKGEIIPGQEDIPPANAAPMPRRKARRQQFEDRSEQ
Download sequence
Identical sequences K9Q4C9
WP_015136291.1.56710 gi|427726137|ref|YP_007073414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]