SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427726162|ref|YP_007073439.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427726162|ref|YP_007073439.1|
Domain Number 1 Region: 56-321
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.19e-76
Family Alanine racemase-like, N-terminal domain 0.00000881
Further Details:      
 
Domain Number 2 Region: 296-456
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1e-50
Family Eukaryotic ODC-like 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427726162|ref|YP_007073439.1|
Sequence length 462
Comment diaminopimelate decarboxylase [Leptolyngbya sp. PCC 7376]
Sequence
MLTVEATENTGLQYLPENPDSLSPNQSLMPLTATVNDQDHLVVGGCDVVELVTQYGSPLY
ILDEHTLRTTCRQYRDSLQKYYSGESLAIYASKAWSCMAICAIVDSEGLGFDVVSGGELH
TTLKAGVSPKKIYFHGNNKSREELSFALDSDVTIIVDNFLELEMLAELTGDRQETANIIL
RLTPGIECHTHEYIRTGHLDSKFGFDPNQIEETFAFVGRHDYLNCIGLHAHIGSQIFEQQ
PHKDLGDVLAGWFKKAGEYGLNLEILNLGGGLGIRYTESDDPPSIEAWSRNVAESLETAC
RKYEVGLPKLIVEPGRSLVGTSCVTAYTVGSRKVVPEIRTYVSVDGGMSDNPRPITYQSL
YRSVIANRLSDKCEETVTVAGKHCESGDVVIKDAQLPTPQPSDILVVLDTGAYNYSMASN
YNRIGRPAAVLVNEGEAQIIIRRETYDDLVRQDCLPERLCQM
Download sequence
Identical sequences K9Q4F7
WP_015136316.1.56710 gi|427726162|ref|YP_007073439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]