SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722022|ref|YP_007069299.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722022|ref|YP_007069299.1|
Domain Number 1 Region: 112-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.29e-43
Family Extended AAA-ATPase domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 353-445
Classification Level Classification E-value
Superfamily TrpR-like 3.4e-32
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722022|ref|YP_007069299.1|
Sequence length 450
Comment chromosomal replication initiator protein DnaA [Leptolyngbya sp. PCC 7376]
Sequence
MTQDPQRLWQEVLVKLEQQLSRPTFETWIEPTTMQQWQDDEVVLCAPNAFVLNHIQKYYG
ALISETIAELVSSPVSVRLTSPEGNTLAATPNLYSSQNNNNLLRRSPKKAQDLNSKYTFS
RFVVGPTNRMAHAAALAVAESPGGDFNPLVLCGGVGLGKTHLMQAIGHYRLDTNADAKIF
YVSTEQFTNDLIASIRKDSIQTFREHYRTADVLLVDDIQFIEGKEYTQEEFFYTFNTLHE
AGKQIVLASDRPPNQIPGLQQRLSSRFSMGLIADIQPPDLETRMAILQKKAEAENIQLSR
SVIEYIATHYTSNIRELEGALLRAVTHIAISGLPMTVENLAPILNPTVEYAPAAPELIVQ
IVSEMVGISIEDLKSASRRREISTARQIAMYLMRQHTDLSLPRIGEAFGGKDHTTVMYSC
DKIGQLLTKDQKISQLVSKISDRINHHQQS
Download sequence
Identical sequences K9PST3
WP_015132253.1.56710 gi|427722022|ref|YP_007069299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]