SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722567|ref|YP_007069844.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722567|ref|YP_007069844.1|
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ferritin-like 1.16e-31
Family Ferritin 0.00068
Further Details:      
 
Domain Number 2 Region: 176-228
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.52e-20
Family Rubredoxin 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427722567|ref|YP_007069844.1|
Sequence length 233
Comment rubredoxin-type Fe(Cys)4 protein [Leptolyngbya sp. PCC 7376]
Sequence
MDMQNARTVDNLEAAFGGESQANRKYLFFADVAKKLGMSDLAKLFRETANQETEHAFAHF
RLLHPELVVKNPDALSDADKKKIAARCLELAIAGETYEYQTMYPEFAAQAQQDKDAGAEA
EFKEQEEESKEHAEMFHTAAKNFGLLTSIEEHHANQYSDALKALDGGEATPRSLGQKWIC
KKCSMIYDPAVGDPDSGIAAGTNFEDIPDDWQCPICGATKKTFVPYEEYVAAA
Download sequence
Identical sequences K9PU80
WP_015132793.1.56710 gi|427722567|ref|YP_007069844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]