SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSTUMT00002719001 from Tuber melanosporum Vittad

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSTUMT00002719001
Domain Number 1 Region: 14-151
Classification Level Classification E-value
Superfamily dUTPase-like 2.75e-32
Family dUTPase-like 0.0000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSTUMT00002719001
Sequence length 175
Comment assembled CDS
Sequence
MTFTSELCATQYLNIWIQKLYQWAKVPTRDSQGAAAHILYANKGIKIPANGQIMIATVIV
IGISEGTYGQIVSRSGLLVKHRLMTMAGVIDADYTGKVKVVLANLAQEYYKVQKCDRIAQ
LIIEKINKEDLHQIEQLEETTRGDKEFGSTDQNQHDITKRIEIKEIKVQAFGRYY
Download sequence
Identical sequences GSTUMT00002719001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]