SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSTUMT00003555001 from Tuber melanosporum Vittad

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSTUMT00003555001
Domain Number 1 Region: 230-368
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000483
Family CBS-domain pair 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSTUMT00003555001
Sequence length 673
Comment assembled CDS
Sequence
MATPARSPLAGLARVALLLTTSLPRLHSHPLFKRSEEGDTESSGFWVNVGIAFFLVVLGG
IFAGLTLGLMGQDEIYLQVIEQSGEGAEKNHAHKVLSLLKRGKHWVLVTLLLSNVITNET
LPIVLDRSLGGGWPAVLSSTVLIVIFGEIIPQSVCVRYGLSIGAYLSPFVLGLMYLMYPV
AYPTALLLDYILGKDHGTVYKKAGLKTLVTLHKNLGPSPSERLNQDEVTIISAVLDLKDK
PVGSIMTPIKDVFTMSSDTVLDEVTMNGILSAGYSRIPIHAPGEPANFVGMLLVKILITY
DPEDEKRVGEFPLATLPETREETSCLDIVNFFQEGKSHMVLVSDSPGENHGALGVVTLED
VIEELIGEEIIDESDVFIDVHKAIRRINPSPLSRRSISTHFPCLGEVAVSSTANIAASFA
VPESITHPTGHIDKQLENLLILDGDPRSTNSTPHNDNDPSHPHPPATVRRSSQQTSLTGI
PENVLPQLKFLGPANLAGNPKSTKYKAVKIKPAGNHDEHARAPLSTSGGIVHVIRAHEPP
CDGNSRADGNGALLSTNPGATTSDPALLLKKPNPGDEYEGPPCTENASRIKKLNKRIARS
GSLVERVEHVSGVPKTIIETTSSGSDGGGSGSESNGKEKNGREKKKRGAKKGGEADNGET
TPLLGGWGGKCSK
Download sequence
Identical sequences D5GA42
GSTUMT00003555001 XP_002837194.1.11696 CAZ81385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]