SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TESG_00113T0 from Trichophyton tonsurans CBS 112818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TESG_00113T0
Domain Number 1 Region: 219-464
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.98e-66
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 13-170
Classification Level Classification E-value
Superfamily Flavoproteins 4.4e-45
Family Cytochrome p450 reductase N-terminal domain-like 0.0087
Further Details:      
 
Domain Number 3 Region: 474-614
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.31e-24
Family NADPH-cytochrome p450 reductase-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TESG_00113T0
Sequence length 614
Comment | TESG_00113 | Trichophyton tonsurans CBS 112818 NADPH-dependent FMN/FAD containing oxidoreductase (615 aa)
Sequence
MATVEKDSSLRTALIAYGSETGNSQDVAEEIGRLTERLYFRTRVAELDALQPRDLYGYRF
TVFVVPTTGQGDFPANGRKFWRSLLLKRLPPTFLQGVSFVLFGLGDSSYPKFNWASRKLY
RRLLQLGASELYPRGEADEQHPEGLEGTFLPWSLDLRKHLLDKFPLKEGQHPIPDEVRLP
PKWILDRYDLEEEDGESRTKQPSRAQEASSPDHDTRPLPGSISATLTDNTRMTPSSHWQD
VRHLVLTASESITYAPGDILYITPRNFPQDVDRLISLMGWEEQADIPLQFVTGDGSPAST
SVSAPSIPFLLGSPGFTLRTLLTDYLDIMAIPRRSFFSQIAHFTKDEMHKERLLEFTNPE
YIDEFYDYTTRPRRSILEVLAEFDTVKIPWRLVSSVLPVLRGRQFSLASGGKLKTSAGGG
TRFELLVAIVRYQTVIKRIRQGVCTRYLASLQPGSTLKVQVQKGGLHSSAKQLSDPSVLI
GPGTGVAPYRSLLWEKAAMAEELQEEPEVAWEELKAQLDLTVITAFSRDQKKKKKKYYVQ
DALRENSAMFYELLHEKGGSVFVCGSSGRMPQAVREALIEAFQAPLGDSAESRQTAEKYL
IDMEKVGRYKQETW
Download sequence
Identical sequences F2RMJ1
TESG_00113T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]