SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TESG_00515T0 from Trichophyton tonsurans CBS 112818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TESG_00515T0
Domain Number - Region: 17-47
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0915
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TESG_00515T0
Sequence length 1424
Comment | TESG_00515 | Trichophyton tonsurans CBS 112818 exonuclease (1425 aa)
Sequence
MGVPKFFRWLSERYPAISQLIAENRIPEFDCLYLDMNGIIHNCTHKDSDSPTFRMTEDKM
FIAIFNYIEHLFGKIKPKRLFFMAIDGVAPRAKMNQQRARRFRTALDAELAKERAIKEGV
EMPKEDAFDSNCITPGTEFMAKLTKQLKYFINKKVSEDAEWQGVEVVLSGHEVPGEGEHK
IMEYIRQAKAQPEYDPNMRHCLYGLDADLIMLGLLSHDPHFCLLREEVTFGRQSQKKSKE
LEHQNFYLLHLCIVREYLELEFQELKLDGALQFPFDMERIIDDFILMAFFVGNDFLPNLP
NLHINEGALAWMFKVYKEILPKLGGYVNEHGTINMGRLRTLLAALSDVEFRFFEAEYSDA
RWLKSKTLDGDQTPTLPEKPNVLTITPAQKHIFNRIKKYVTHRPMDEAGQPIPLDLSPSL
PARDRKFVEQLADSLHLKWSSVLNQHEERFLRVQLPANDDDDDEDDDDDESQIAILRVLK
KYENAKVKDVTAEDAQMAAEKKYEKKFQDWKDKYYKGKFGWGLENAEEMRKLTENYVQGL
QWVLFYYYRGVASWPWFYRYHYAPMISDIHLGLGADVDFKLGQPFFPFQQLMGVLPDRSK
KIVPVAFHSLMTSPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFIDEERLLKAMATKEH
LLTPEEKARNSFGVTLKFSYSPDVEFLYPSSLPGIFPDVSRCRCIENVFELPTMEGLDPY
VGLVEGVKIGAEALYGFPSLQTLQQTGQLGFHGVCVFQQESRNESMVVTISDPEIGGNTA
DAKTKLGKRVHVGYPFLQEAKVVCVSDELFDYVQVDGEEHVVPIPHTPTQISQWKKKAEK
IESYYSKRLGMVIGDVETIVRVEMLKGLKKTPDGATVKEFTEIPGVETEYAAQLIVDSVV
SEDLRFIEREAVPIEEEFPEGARAFFLGEYNYGAPVHVTGHEDGKLSGLLSAVKGKEPEF
GREHVLNAEKLSKYTPSFAIARNLRLSPLTLAKITSSFSVNMDGTRVNLGLNLKFEAKKL
KVLGYSRRGNSGWEFSERAIGLLQDYMIKFPDFIAGIQRKPQGDLFEPSDFYPADIAKEK
IKEIQAWLKSIESKSFERVPLEAEQLDSSIVQAIEKSADELSQSRPTPVAQKIRGVPRNA
LLKPTDAEHRLNNQHFQLGDRVLYAQDSGKVPIASRGTVVGLTRTSRNLLLDVLFDVSFM
SGTTLADRCSPFRGSTVPSSSVLNLTNKQLIALSRATAQNKEQAREQQLPIRAAPQTMSG
MGQLKDAPAPPPLMNSYRGAATGQPSNGKPNGAPVSNWRGRGRGTVPTRNHATPEGTHGS
GRGRGNSNSHTSRRGNGPPSRGGGRGGYVNVESMNPDAGVVSHNPNFRPRPYNTVPPPAS
LNQPTGRGRGVRGRGRYASSSMPRAGRGRGRGGHAGASTGETTA
Download sequence
Identical sequences F2RNP9
TESG_00515T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]