SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TESG_02631T0 from Trichophyton tonsurans CBS 112818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TESG_02631T0
Domain Number 1 Region: 4-460
Classification Level Classification E-value
Superfamily Cytochrome P450 6.16e-99
Family Cytochrome P450 0.0000000337
Further Details:      
 
Domain Number 2 Region: 667-896
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 8e-56
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0054
Further Details:      
 
Domain Number 3 Region: 498-645
Classification Level Classification E-value
Superfamily Flavoproteins 1.91e-34
Family Flavodoxin-related 0.0017
Further Details:      
 
Domain Number 4 Region: 898-1063
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-31
Family NADPH-cytochrome p450 reductase-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TESG_02631T0
Sequence length 1064
Comment | TESG_02631 | Trichophyton tonsurans CBS 112818 fatty acid hydroxylase (1065 aa)
Sequence
MSEPIPGPAPLPIVGNAYNLDLVNSFTTFGNLTDTYGPIFKLTLGGEEKIFITTQSLMDE
VCNEKRFSKLVAGSLAQIRNGVQDGLFTAHPGEHNWEIAHRVLMPAFGPLSIRAMFDEMH
DIASQLVIKWARFGPNEKIHVTDDFTRLTLDSIALCAMGTRFNSFYHEDMHPFVHAMVGF
LAESGARASRPAVVQYFMHSAQQQYDADIELMKKVAGDLVADRKANPNDKKDLLNAMLKG
KDARTGEQMTEESIINNMITFLIAGHETTSGLLSFLFYYLLKHPSAYQAAQRQVDEVVGR
GPITVQHMSKLPYIEACMRETLRLSPSAIAIQMQPRPDGQEDPIYIGQGKYEIKKGQAIV
CVIPQVHRDPTVYGDDANLFRPERMLDEPFAKLPKNSWKPFGNGVRGCIGRPFAWQETIL
TTAMLLQNFNLRFDDPSHQLQIKQTLTIKPKDFFMRATLRHNVDPVQLEKMLHVNIEAEA
KAAEKDRTAGISSAGLAKKPMTILYGSNAGTCEALAHNLARDASSRGYSAQVDPLDSGVD
KVPKDQPVIVISSSYEGQPPDNAAHFVEWIQGLGSGAMTGVKYAVYGCGNHDWTSTFHRI
PKLLDTEFKRPGATRVADIGLGDVADGDIFNHFDKWQDEKLWPSIGGDVDPAEEGTVEVD
IDTDARKSTLRQDVREATVISNKVLTAPGEPEKRHLVLTLPTGMSYKAGDYLAVLPINDQ
RNIRRALNRYNLPWDAMLTIKVGANTTLPTGHPVSAMDVLSAYVELGQPETRKNVARIAS
SISDEKVREEVLALSKEGFANEIQKKCRSPLDILEEYPMAELPLGDFLAMLPPMRIRQYS
ISSSPLADPKVASITWSVLNAPSRVADSKRFLGVASNFLSKVQEGDRIHVAVKPSHGNFH
PPKDTENTPILMFCAGTGLAPFHGFVQERAIQIQAGRKVAPAYLFIGCRHPEKDALFKDE
LRKWETDGVVTVFYAFSAASEQSKRCRYVQDRLWEERGEMRKVFDQGAKLYVCGTSRVGE
GIASTVKKIFQDYCASVGKPKTDEEVERWFQDIKSNRFSSDVFA
Download sequence
Identical sequences F2RUS5
TESG_02631T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]