SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TESG_04426T0 from Trichophyton tonsurans CBS 112818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TESG_04426T0
Domain Number 1 Region: 459-821
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.26e-72
Family PFOR PP module 0.0000226
Further Details:      
 
Domain Number 2 Region: 1089-1294
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000228
Further Details:      
 
Domain Number 3 Region: 788-943
Classification Level Classification E-value
Superfamily Flavoproteins 1.51e-38
Family Cytochrome p450 reductase N-terminal domain-like 0.05
Further Details:      
 
Domain Number 4 Region: 1378-1514
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.22e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000133
Further Details:      
 
Domain Number 5 Region: 956-1088
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.05e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0021
Further Details:      
 
Domain Number 6 Region: 1297-1374
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.5e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.00099
Further Details:      
 
Domain Number 7 Region: 309-447
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000628
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0048
Further Details:      
 
Domain Number 8 Region: 6-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000224
Family PFOR Pyr module 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TESG_04426T0
Sequence length 1532
Comment | TESG_04426 | Trichophyton tonsurans CBS 112818 sulfite reductase beta subunit (1533 aa)
Sequence
MAGITTAAEAVARVAYLSSDVVLSVQPTKETDSVFSGTLSRLAQQQVKNVLSDSVPEIRP
VRHNEDPLLSVYHPLQQGQTVSVTTSSTVLLAAIPHLYRLANYSIVIHVHLEPSQFADYS
VISSIRQCGFSFLHSETLQEAHDIGLTAHSLALTSGKGVIHFFDLRNSEKDQPVVAEDAA
FVKDILEVSPVRATHTPVDVPQTIYADSGRVAIVTDQGFGGPVINPADASTSADNSLPIP
SPKSAAPSVDPSSVGSSRRGSILDSHVPSSSATTAETITTRPVDAADIFQIVSIIWDAFS
ARVGRNYHAIEYSGPQDAKLALFVFGSTRVFLDTLNNPAHKDEFKDVGIITARLYRPWIG
SQILRAISDSIERIAVLEQVRKTTRWGPSFLDLLSSMSQPPSSTRPTPTLVGYRPGYIEP
ATASQAVRGVIQNLTLEAPIQNLDIGTETIPQPDTQLQQPSHENAYTKILNQLFSDRLYI
ANQLGSQNAGISATIAASPEYGFGSLLARKERRVNLKKDVEEAVRANGFTNESSKQLLSK
WALNESNSAKVNQIAPDVVDALTADGSSPAEDLLQSKELFFKESQWLIGSDAWAYDLGNS
GVHHVLASNENVNMLIIDSQPYSQRTAADPTRRKKDIGLYAMNFGHAYVASVAVYSSYTQ
VLQAIAEAEQFNGPSVVVAYLPYHKESDSPLTVLQETKKAVEAGYWPLYRWNPENAEKGL
PNFSLDSERIRRELEEFLRRDNQLTQLMNREPKFAASLSESYGTEVRALKKRAAKKAYDQ
LMEGLLGAPLTILFASDNGNGENLAKRLANRGKARGLKTMVMAMDDYPIEDLSTEENIVI
ITSTAGQGELPQNGRGFWETVKNAGDLDLSAIKYSVFGLGDSHYWPRKEDKLYYNKPAKD
LDARLAFLGGKKLADIGLGDDQDPDGYQTGYSEWEPKIWKALGVDNVEGLPDEPAPLTNE
DIKIQSNYLRGTIAEGLRDESTSALAESDLQLTKFHGTYMQDDRDLREERKAQGLEPKYS
FMIRCRLAGGVATPSQWLQMDEISSAQGNETMKLTTRQTFQFHGVVKGKLRAAMQAINRA
LMSTIAACGDVNRNVMCSSLPELSTYHSEVHAVSKLISDHLLPATTAYHEIWLKDENDNK
VQVAGDAVVDHEPLYGPTYLPRKFKITIAIPPHNDTDVYAHDIGLIAIKGADGHLEGFNV
LVGGGMGVTHNNKKTYPRTGSMLGYVPAKQAHIVCEKIMLVQRDHGDRKNRKHARMKYTV
DDMGVDVFKGKVEALLPEDLRFTEPRPFKFDSNVDTFGWIKDEKGLNHFTCFIENGRVED
TSDFLMRTGLREIAKLNKGEFRLTGNQHVIISNIKDEDLPQIKALMAKYKLDNTAFSGLR
LSSSACVAFPTCGLAMAESERYLPILITKVESYLEENGLSRESIVMRMTGCPNGCARPWL
AEVAFVGKAYGAYNMYLGGGYHGQRLNKLYRSSIKEAEILDIMKGLLKRYALERQTDGDQ
PERFGDWCIRAGIIKETTEGKNFHEGVAEDEE
Download sequence
Identical sequences F2PHE9 F2S0A6
TESG_04426T0 TEQG_00370T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]