SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TESG_05555T0 from Trichophyton tonsurans CBS 112818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TESG_05555T0
Domain Number 1 Region: 4-201
Classification Level Classification E-value
Superfamily Flavoproteins 7.34e-61
Family WrbA-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TESG_05555T0
Sequence length 204
Comment | TESG_05555 | Trichophyton tonsurans CBS 112818 flavodoxin (205 aa)
Sequence
MASPKIAIVYYSMYGHIKTLAEAEKKGIEAAGGTADIYQIAETLSEEVLTKMHAPAKSNH
PVAEPKDLLAYDAILFGIPTRYGNFPAQWKAFWDKTGGIWAKGEFYGKYAGVFVSTGTPG
GGQESTVIASMSTLVHHGMIFVPLGYKNTFQMLSNVSEVRGGSPWGAGTFAGADGSRQPT
ALELELAQTQGKGFYEAISKVKFA
Download sequence
Identical sequences F2S3M0
TESG_05555T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]