SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TERG_00777T0 from Trichophyton rubrum CBS 118892

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TERG_00777T0
Domain Number 1 Region: 93-337
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.34e-73
Family Glutamine synthetase catalytic domain 0.0049
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 5.62e-21
Family Glutamine synthetase, N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TERG_00777T0
Sequence length 341
Comment | TERG_00777 | Trichophyton rubrum CBS 118892 glutamine synthetase (342 aa)
Sequence
MGLDQRGKVLAEYVWVDAHGGVRSKTKTLSRPVTSADELPEWNFDGSSTGQAPGHDSDVY
LRPCAIFPDPFRGGDNILVLCETWDSDGSPNKYNYRHEAARLMRTHEKEQFWFGLEQEYT
LLDADGWPFGWPKGGYPGAQGPYYCGVGTGKAQCRDIVDAHYKACLYAGISISGINAEVM
PSQWEYQVGPCEGITLGDQLWMSRFLLNRVAEDFGVVISFAPKPIPGDWNGAGLHSNVST
AAMRAEGGMKVIEAAMKKLEARHPEHIAVYGEGNEDRLTGRHETGSIDKFSWGVADRGGS
IRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETLCGSD
Download sequence
Identical sequences XP_003238790.1.23396 TERG_00777T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]