SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TERG_01015T0 from Trichophyton rubrum CBS 118892

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TERG_01015T0
Domain Number 1 Region: 257-305
Classification Level Classification E-value
Superfamily LysM domain 0.00000000314
Family LysM domain 0.0043
Further Details:      
 
Domain Number 2 Region: 136-186
Classification Level Classification E-value
Superfamily LysM domain 0.000000222
Family LysM domain 0.011
Further Details:      
 
Domain Number 3 Region: 33-77
Classification Level Classification E-value
Superfamily LysM domain 0.00000837
Family LysM domain 0.0062
Further Details:      
 
Weak hits

Sequence:  TERG_01015T0
Domain Number - Region: 192-265
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0994
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TERG_01015T0
Sequence length 308
Comment | TERG_01015 | Trichophyton rubrum CBS 118892 hypothetical protein (309 aa)
Sequence
MMVNIQLILGVIILLGTRKAATAALPPHPCAFAATAANGDTCQSLAAERGIGMDQFLKRN
PGVNCNALVAGKTYCLSADDSAPGPTASLNPSPKVPTTTLRAVQTMSPKASTGTPAITLV
SRSGPIRFMTGMAPDCLFYHPVAPGDTCQSIVDKYKSFTLDQFYAWNPATGRNCESLWLG
YYTCVGVKGGPNSPSQQPPSQQPPSQQPPSQQPPSQQPPSQQPPSQQPPSQQPPSQQPPS
QQSNTSQQTQPNVNSKCNKWYQVVPGDYCQKIADKFNISLQTFYAWNPSVGSTCASLWAG
YNVCVGSA
Download sequence
Identical sequences A0A178ET29 F2SEG4
XP_003239028.1.23396 TERG_01015T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]