SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TERG_01296T0 from Trichophyton rubrum CBS 118892

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TERG_01296T0
Domain Number 1 Region: 118-475
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 7.16e-88
Family Glutamine synthetase catalytic domain 0.0000754
Further Details:      
 
Domain Number 2 Region: 21-111
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0000222
Family Glutamine synthetase, N-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TERG_01296T0
Sequence length 496
Comment | TERG_01296 | Trichophyton rubrum CBS 118892 glutamine synthetase (497 aa)
Sequence
MAAETVTLDILEEVLEDDGQVKVAGFDADGILRGKLVSKRKFLSIAQDGFGFCSVIFGWD
MHDQTYFKELGISNKENGYRDLVAVPDLSSFRRIPWERNVPFFLVSFLDPETKKAISACP
RGLLRAATAGLEEKGYKAMAGVEFEFYQYRAPPTVDSAERNSTGTARFLQYNPVNDLQPL
TEGMFGYSLTRTVHNQEYFYRIFDTCREFECDIESWHTESGPGVFEAALQFGEVKDMADR
GGLFKYVVKSVGSKFGITPVFMAKPRQGLPGNSGHMHVSLVDKSGTNLFVRESPDPSPPY
PDLAYISDIGRHFLAGILAGLPDIMPILAPTINSYKRLVENFWAPVTVSWGLEHRAASIR
VISPPTCSGKGTRFEIRVPGADVNSHYVLAAIVALGWRGVEKKLDIPIPPLPKGEDVGGT
ADKGERLAKNLKEAVARFTDKESVAREALGDEFVDHFGGTREHEIRLWEEAVTDWYVLFI
GFLFLFVASGVTVRSG
Download sequence
Identical sequences A0A022VNX7 A0A022XDL7 A0A178ERZ4 F2SBR3
TERG_01296T0 XP_003239315.1.23396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]