SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TERG_02133T0 from Trichophyton rubrum CBS 118892

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TERG_02133T0
Domain Number 1 Region: 139-450
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.27e-53
Family Glutamine synthetase catalytic domain 0.001
Further Details:      
 
Weak hits

Sequence:  TERG_02133T0
Domain Number - Region: 37-126
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0889
Family Glutamine synthetase, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TERG_02133T0
Sequence length 455
Comment | TERG_02133 | Trichophyton rubrum CBS 118892 hypothetical protein (456 aa)
Sequence
MAPHANRAKVDDAKANSMAGTEGSNALHALLTLYPSICFLRCQWQDYSGVVRARIVPMEQ
AQAIAAEKRRLHVPACAFHLTVSHENIPEMDPRGYHWLIPDWDSLYPASQQLGVDPSYAS
VMCGVVEHLPIRPELNWNYCPRKALKTVVEKAEKLLHVHFLVDFEVEFQVMKAAADGKIG
PHSSGLGRCAISGLRDPCVAHIQEVVHILIKAGVGVGAFQTEGDRGQYEIALEPQSPLRA
IDELIFVHDTLKSVFARHGLIATMAPRPVASHKQVAGQHTHISLNPPNKETSFLAGILRR
LPGLCAFFLPYDLSYERVQPYLAGHIVAWGSENRAVPVRQIKSGHWELRCVDATANMYVA
LAAVISAGTIGCINEEPLVWPDTGLITEHFPTSGVEPFPKSVAGSLEQLEKCCDSLQEFM
ESRILRHYIAVKRYEAPRLQTLPEETVRQLLCEIF
Download sequence
Identical sequences A0A022VVI7 A0A178F078 F2SG07
XP_003237412.1.23396 TERG_02133T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]