SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TERG_01762T0 from Trichophyton rubrum CBS 118892

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TERG_01762T0
Domain Number 1 Region: 456-816
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.69e-74
Family PFOR PP module 0.0000205
Further Details:      
 
Domain Number 2 Region: 1085-1290
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000221
Further Details:      
 
Domain Number 3 Region: 784-939
Classification Level Classification E-value
Superfamily Flavoproteins 2.43e-38
Family Cytochrome p450 reductase N-terminal domain-like 0.053
Further Details:      
 
Domain Number 4 Region: 1374-1510
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000133
Further Details:      
 
Domain Number 5 Region: 952-1084
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.23e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0021
Further Details:      
 
Domain Number 6 Region: 1293-1370
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.05e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.00099
Further Details:      
 
Domain Number 7 Region: 305-443
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000157
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0045
Further Details:      
 
Domain Number 8 Region: 8-191
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000277
Family PFOR Pyr module 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TERG_01762T0
Sequence length 1528
Comment | TERG_01762 | Trichophyton rubrum CBS 118892 sulfite reductase beta subunit (1529 aa)
Sequence
MAGITAAAEAVARVAYLSSDVVLSVQPTKETDSVFSGTLNRLAQQQVKNVLSDTVPEIRP
VRHNEDPLLSAYHPLQQGQTVSVTTTSTVLLAAIPHLYRLANYSIVIHVHLEPSQFADYS
IISSIRQCGFSFLHSETLQEAHDIGLTAHALAQTSGKGVIHFFDLRNSEKNQPVVAEDAA
FVKDILEISPVRATHTPVDVPQTIYADSGRVAVVTDQGFGGPVINPASADTSLPIPSPKS
AAPSVDPSSVGSSRRGSILDSHVPSSSATTAETITTRPVDAADIFQIVSIIWDAFSARVG
RNYHAIEYSGPQNAKLALFIFGSTGVFLDSLNDPAHKDEFKDVGIITARLYRPWIGSQIL
RAIPDSVERIAVLEQVRKTTRWGPSFLDLLSSMSQPPSSTRPTPTLVGYRLGYVEPATAS
QAIRGVIQNLTLEAPIQNLDIGTETIIQPDTQLQQPSHENAYTKILNQLFSDRLYIANQL
GSQNAGISATIAASPEYGFGSLLARKERRVNLKKDVEEAVRANGFTNETSKQLLSKWALN
ESNSAKANQIAPDVIDALAADGSAPAEDLLQSKELFFKESQWLIGSDAWAYDLGNSGVHH
VLASNENVNMLIIDSQPYSQRTAADPTRRKKDIGLYAMNFGHAYVASVAVYSSYTQVLQA
IAEAEQFNGPSVVVAYLPYHKESDSPLTVLQETKKAVEAGYWPLYRWNPENAEKGLPNFS
LDSERIRRELEEFLRRDNQLTQLMNREPKFAASLSESYGSEVRALKKRAAKKAYDQLMEG
LLGAPLTILFASDNGNGENLAKRLANRGKARGLKTMVMAMDDYPIEDLSTEENIVLITST
AGQGELPQNGRGFWETVKNAGDLDLSAIKYSVFGLGDSHYWPRKEDKLYYNKPAKDIDAR
LAFLGGKKLADIGLGDDQDPDGYQTGYSEWEPNIWKALGVDNVEGLPDEPAPLTNEDIKI
QSNYLRGTIAEGLRDESTGALAESDLQLTKFHGTYMQDDRDLREERKAQGLEPKYSFMIR
CRLAGGVATPSQWLQMDEISSAQGNETMKLTTRQTFQFHGVVKGKLRAAMQAINRALMST
IAACGDVNRNVMCSSLPELSTYHSEVHAVSKLISDHLLPATTAYHEIWLKDENDNKVQVA
GDAVVDHEPLYGPTYLPRKFKITIAIPPHNDTDVYAHDIGLIAIKGADGHLDGFNVLVGG
GMGVTHNNKKTYPRTSSMLGYVPAKQAHIVCEKIMLVQRDHGDRKNRKHARMKYTVDDMG
VDVFKGKVEALLSEDLRFAEPRPFKFDSNVDTFGWIKDEKGLNHFTCFIENGRVEDTSDF
LMRTGLREIAKLNKGEFRLTGNQHVIISNIKDEDLPQVKALMAKYKLDNTSFSGLRLSSS
ACVAFPTCGLAMAESERYLPILITKVESYLEENGLSRESIVMRMTGCPNGCARPWLAEVA
FVGKAYGAYNMYLGGGYHGQRLNKLYRSSIKETEILDIMKGLLKRYALERQTDGDQPERF
GDWCIRAGIIKETTEGKNFHEGVAEDEE
Download sequence
Identical sequences A0A178F117
XP_003237040.1.23396 TERG_01762T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]