SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TERG_02447T0 from Trichophyton rubrum CBS 118892

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TERG_02447T0
Domain Number 1 Region: 171-390
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.27e-91
Family ATP sulfurylase catalytic domain 0.0000000047
Further Details:      
 
Domain Number 2 Region: 4-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.39e-52
Family ATP sulfurylase N-terminal domain 0.000000158
Further Details:      
 
Domain Number 3 Region: 391-502,539-571
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.2e-38
Family ATP sulfurylase C-terminal domain 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TERG_02447T0
Sequence length 573
Comment | TERG_02447 | Trichophyton rubrum CBS 118892 ATP sulphurylase (574 aa)
Sequence
MSNPPHGGVLKDLFARDLPRHDELAAEAEKLPALTLTERQICDLELILNGGFSPLEGFMN
EKDYNGVCAESRLADGNLFPMPINLDVTKENIEEMGIKPGARITLRDFRDENNIAIITVE
DVYQPDKKKEGELVFGGDPEHPAIIYLNNTTKDFYVGGKLEAVNKLNHYDYVGLRFTPAE
LRAHFDKLGWTKVVAFQTRNPMHRAHRELTVRAARARQANVLIHPTVGLTKPGDIDHFTR
VRVYEALLPRYPNGMAALGLLPLAMRMGGPREALWHAIIRKNHGCTHFIVGRDHAGPGKN
SAGQEMYGPYDAQHLVEKYRDELGIEVVEFQMLTYLPDSDEYRPHDQVPEGTKTLNISGT
ELRKRLRTGASIPEWFSYPEVVKVLRDSNPPRAKQGFTIFLTGYLNSGKAAIARALQVTL
NQQGGRPVSLLLGDTVRHELSSELGFSREDRDKNIQRIAFVASELTKAGAAVIAAPIAPY
AHSRDAARTTISSKGSFFLIHVATSLEYAEKTDKRGVYARARRGEIQGFTGVDDPYEAPT
NADLTVDIEKQSVRSIVHEIILMLESQGFLERS
Download sequence
Identical sequences A0A022VTE5 A0A022XK41 A0A178EZK5 F2SH93
XP_003237732.1.23396 TERG_02447T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]