SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TERG_07306T0 from Trichophyton rubrum CBS 118892

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TERG_07306T0
Domain Number 1 Region: 2-161
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.13e-26
Family N-terminal domain of MutM-like DNA repair proteins 0.0021
Further Details:      
 
Domain Number 2 Region: 156-245
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.88e-23
Family Middle domain of MutM-like DNA repair proteins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TERG_07306T0
Sequence length 387
Comment | TERG_07306 | Trichophyton rubrum CBS 118892 formamidopyrimidine-DNA glycosylase (388 aa)
Sequence
MPELAEVSRIVNYIKKHLVGHTIAKVVANHDDLLFGKVGTSADEFKKHMHGKTVIGAGQQ
GKYFWMIMSSPPHPVMHFGMTGWLKIRSENTYYRSNGKDENVEADVWPPKFWKFLLETDN
EPKTEAAFVDARRLGRVRLVDCPGDEIRKYTPLKENGPDPVIDKAILTEDWLKALVRRKK
VPIKALLLDQANISGLGNWMGDEILYHARIHPEQYSDTLRDNQIKELHSSINYVCSVSVD
LKGESSDFPTDWLFHHRWNKGKKGAAGKLPSGEPIVFVTVGGRTSAVVPSVQKKGGEEEE
EETDTKPKKAIGKAKATPKVKAEEKDDASASTPATPSKKRKQPAAKAVKEEDSAATPASK
KSRATRVKAEPEAPKVPLRRGRSAAKN
Download sequence
Identical sequences A0A022WBP6 A0A022Y369 F2SXL3
XP_003232460.1.23396 TERG_07306T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]