SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thite1|111096|fgenesh2_pg.1_#_1252 from Thielavia terrestris NRRL 8126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thite1|111096|fgenesh2_pg.1_#_1252
Domain Number 1 Region: 974-1105,1137-1338
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-69
Family p120GAP domain-like 0.00055
Further Details:      
 
Domain Number 2 Region: 268-425
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.22e-36
Family Calponin-homology domain, CH-domain 0.0000299
Further Details:      
 
Domain Number 3 Region: 1560-1660
Classification Level Classification E-value
Superfamily RGC domain-like 6.54e-29
Family RGC domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Thite1|111096|fgenesh2_pg.1_#_1252
Sequence length 1661
Sequence
MSSSYRPHPLRQSQTADYAVSRQPSNASSSASSGYSSTSSGAFEFSRGSMSSSPASIYST
YGHKRGLSEVPRRTPPPSSSLQSHPSKSVHENIYHAARQSLRPLPPLPRPTTPPRVPARH
DRGHSVDIGKLSIADHAQTSPPPPTPPTPPRHSPAARPTSMVLTRSDSVRRGSDPIPPSL
VHAHTAPLSTPDLERLGRSSTNQLRTLSKLAQSGSAEEFSITSSAQEVVGLRGRRRLQRT
DGAGANRPAQRTGGYGWEGRNWMDKQRQFLQAYEYLCHIGEAKEWIEDVIQRTIPPIVEL
EETLRDGVTLAEVVEALNPHRRFKIFRHPRLQYRHSDNIAIFFRYLDEVELPDLFRFELI
DLYEKKNIPKVIHCIHALSWLLYRKGIVGFRIGNLVGQLEFEHHELEATQKGLDKLGANM
PSFGNMGADFGVEEPPEPEETEEERIDRELAENEAGVVELQAQIRGAVLRMQLGQIMQHL
WDSEDWLVDLQARVRGDFTRQIMGYRLQMRRFAIRLQSAARGFLVRRRQAWTQHVWKSVE
GDILKLQSLVRARKARNEVREQRSQLMVVAGPIRDIQATFRGFLLRKKMITQEQEVKHMA
APVSGLQAAVRGLLLRKRLEEDRAELESQASIIACLQAAAKAVLTRNQVALQREALESLG
PVWKSLQAACRGNLARGSVGMLKAELGQHSPSLGVLQAHIRAAAVRREISEKLEGLAHAE
DEIVALQSAIRAMLERNRVSNLLDGLDAQEASIIELQSRIRGFLYRQQHQAFLNELHTGA
EEVSALQSLARAMLLRDSVARVLDELEENEESIGEIQAAAKAFIVRARFEAKKRHYNENM
QKVVKIQSFVRAKLQGQAYKSLTSGKNPPVNAVKNFVHLLNDSDFDFNEEVEFERLRKTV
VQQVRQNEMLELYIDQLDIKIALLVKNKITLDEVVKHQHNFGGHASNLLANSSIASVNQF
DLKALNKGSRKKLESYQQLFFALQTQPQYLARLFRRLREQGTAEKECKRIEHLMMGLFGY
AQKRREEYYLLKLIGRSIREEVDASNTLQDYLRGNFFWTRLLHNYTRSPRDRKFLRDLLG
PLIRDNIIEDDELDLESDPMQIYRSAINNEELRTGRPSSRPLDIPRELAIKDPETKAVFI
DHLRDLREICDQFLVALEDLLPRMPYGLRFVCRQTFDALCQRFQREPRQRLLQVVANWLW
KSYLQPAVTKPENVGVIDKQLSPLQKRNLGEVAKVLGQIASGRQFGGDNIYLQPLNAFVA
ESIERLAQLTENLIAVPDAESTFDIDEFNDLYAKNKPTLYIKMTDIFAIHSLIASELPHL
SLSRDDMLREIMQDLGSAKHNESEMTAAGSSDIQLFLTPKLHDLEDPDADVKALFMETKR
CILYIIRVQTGANLLEILVKPITPEDEHKWAMLLREDFASGSNTRGAYSDANMVDVTRMS
YHDLKRIALENVLKLEQMGRISRHNHYQDILNAIALDIRTKSRRRVQRQRELEGVRLTLA
NLHEKAKYLEQQRKSYDDYIEQAMATLQNKKGKKRFLLPFTKQYNHQRELERSGRVPKFG
SYKYSARALSDKGVVVSWQGIPERDWGQINLTISCDEVGVFSIEGSRGHIQMPGASALVP
IEDLLQAQFETHQFMTLFEGCLRLNVNLLLHLLYKKFYRTQ
Download sequence
Identical sequences G2R3B0
XP_003652257.1.77082 jgi|Thite1|111096|fgenesh2_pg.1_#_1252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]