SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thite1|121635|fgenesh2_pm.3_#_230 from Thielavia terrestris NRRL 8126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thite1|121635|fgenesh2_pm.3_#_230
Domain Number 1 Region: 12-137
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.95e-33
Family Calponin-homology domain, CH-domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Thite1|121635|fgenesh2_pm.3_#_230
Sequence length 683
Sequence
MASVTSLDKDLRKLRLDKYTPAAANEARQWIEGVLGERLPGDDLLEGLKDGVALCKLVNL
AVGPPGVKFKKSPMPFVQMENISQFLHACQLPPLNLQQHDMFLTVDLYEQKDPAQVLQCI
GAFSRAANSVNPSAFPTAIGPRSSRVMSPQSTGPTTPTGLRARGISNASNTSSSLYGKGP
ALAPSKTGDSGSGRWSPTKSPGQSASSPPPPVSSWSKKEQEGATSPAWNIAQYGYMGGAS
QGNLGIAFGGRRQITSAGPYVPNMAEKEKRRKEMEAEAERRQQEEERRRKAEIEAEEERA
RLEEERRWEEETRRLREEERRRIEEEKRRWAEEERQWKLTEEKRRREEEEAEARLKEERQ
KARNRKSNTQLRGQYLSQYQAEQESADKARIRELEKQLEEARRREAEYEKERQGRSLRPG
TSEDAKARSRSRSRAAQPVSRQDSWSVRDERDFLAKQWTQHQQQLEQHEEEPGDAAAPPP
PLPTAPRPLPDPATAAVAPAKVKTHRTGEAPPAFPVRKQHTGSRPLPDPAAYASSSPEAS
PAMSRTDRFPASNPSPAQDAPKPTYARELLGATDERDAEDRRRAEAQKKTAAAGRASKSL
LEREMELERQRQREWEEAQKETARAARPADGAVDGIGGGIGGRWDVSQWTGYTGGDNQNR
GSQGIGAGRRQIVGPRPLPNPPR
Download sequence
Identical sequences jgi|Thite1|121635|fgenesh2_pm.3_#_230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]