SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thite1|122113|fgenesh2_pm.3_#_708 from Thielavia terrestris NRRL 8126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thite1|122113|fgenesh2_pm.3_#_708
Domain Number 1 Region: 6-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-83
Family Calponin-homology domain, CH-domain 0.0000323
Further Details:      
 
Domain Number 2 Region: 247-370
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-29
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 3 Region: 471-599
Classification Level Classification E-value
Superfamily EF-hand 1.11e-17
Family Calmodulin-like 0.0061
Further Details:      
 
Domain Number 4 Region: 373-478
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000528
Family Spectrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Thite1|122113|fgenesh2_pm.3_#_708
Sequence length 665
Sequence
MAYAEQQRWITVQQKTFTKWLNTKLEVRNLEVKDLVQDLSDGVLLIHLLECLSGESLGRY
ASKPKLRVQRFENANLALNFIKSRGIQMTNIGAEDVVDGNRKIILGLIWTLILRFTISDI
NEEGMTAKEGLLLWCQRKTACYDEVDVRDFSASWNDGLAFCALLDIHRPDLIDYDALDKS
DHRGNMQLAFDLAHKEIGIPNLLDVEDVCDVAKPDERSLMTYIAYWFHAFSQMEKVENAG
RRVEKFVNNMRGAWDMQSAYERRMAALLKAIRAQMESWQQSKFEGTYADAKAQAAEFAAY
KKGLKREWVAEKSELATLLGNIKTKLGTYRLRPYEPPAELRLEVLDQEWANLTKAEMARG
QLINETIRDIKNALRKSFADKANDFALALNTIQLAISGLEGDVEDQLHHVRKLSDNLPPL
DAFLKTIAAVDAKCQEANIEENDFTTYTYDELCYELSLVSSSVAKKLAFLENQMVARNMT
NLTPIQLEEFESVFRHFDRDNTNTLSELEFSAALASLGLIFSEEEMHDYFVDTSGGRDRV
TFEQFIRFMVDVTEDQNTAEQVFQSFREVADGKPYVTEMDLRHSLVPDDVIEKLVEIMPS
HHGPDMQADRGQPQYDYIAFMDKLMGDGGDLQAQPASGRYKIQKPTSNLKTVRERIPTQA
DLIPR
Download sequence
Identical sequences jgi|Thite1|122113|fgenesh2_pm.3_#_708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]