SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thite1|136307|estExt_fgenesh2_pm.C_70122 from Thielavia terrestris NRRL 8126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thite1|136307|estExt_fgenesh2_pm.C_70122
Domain Number 1 Region: 211-410
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-41
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 910-1022
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.85e-19
Family PB1 domain 0.0055
Further Details:      
 
Domain Number 3 Region: 416-545
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-16
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Thite1|136307|estExt_fgenesh2_pm.C_70122
Domain Number - Region: 103-189
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0534
Family Calponin-homology domain, CH-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Thite1|136307|estExt_fgenesh2_pm.C_70122
Sequence length 1024
Sequence
METVDKMNVIGMPSATRASQLSGSTFPATSSSASLNSLSTATTAGAPPNGQVVATSNIIN
QRADASRSLYQICVSLKQRLAKVPGFEGYMEQLEQMSKDPDEGGPVESLWKLLRTGYPLL
AIYNALQPDTPLQVQEPAGASEAKRSKIAILRFVEACKSKLMLPPTEVFIITDLAGNDTT
GFVKVTSVINHVLDLAEQRGLLLQVQPYPEDDSMQTGSQMSYRDYIVRELVDTERKYVQD
LENLHDLKKTLEQNGIIPGDVVHNIFLNINAILDCQRKFLIRVETTNSMPPERQEWGSPF
VAYEETFNTCYQPFIANQRKAGQLASQVFDSIRTADHPVACDFNTLDGFLLKPMQRLVKY
PLLLKDLLKKSEDEATKADLTAGIEAAERVLQKANEAVDRDLLDEALEDLIVRVEDWKKH
RVEQFGKLLLHGVYTVITGKGDQEKDYEIYLFQCILLCCKEKDPSKGKDKKDKTRSTGPK
VRNKNAKLQLKGRIFMTNVTDVVAMSKTGSYTVQIWWKGDPGVENFMIRFQNEETMKKWA
AGLDQQRKENAPQHHSNADKGVPNFAWIANNVPENPYVEPDGSDEEDDREAGENSLAGTT
PTPSQYSTPITTMPGTMQRNPSGTNLRRERSSTSDSTQSVAGVGRVPPPRFPMIPPPTSS
LSLKTQVPGQPSPGPRVPTDSYFSPMTESPVSSRTSTTSGIFSAQGYQFPKTTTPQPWNA
DDMNRHTAPAAPRAPSRDGSSPANSFGVNGRNPRGPSLPVMPRDLAQSAQQQQQRSRSYS
TPDINGQASRGQQSIPAVPGIPPHLHQGQPPYPTHARHDSSIPRSNTGSPANDLPLRTNT
NSPGTQRPRQYGGTMAQFPTQPVYPRQGTPGSVTNLPPPGPPPPGIAPLAPIDPSRTVAP
GLGTAPLPSSHGMVPPTPDIAMPNQLLVKVNWDAGRYFTLVAQYNITYQSLVDRIDVKLA
RHTQSNTSIAKGDLKLRYRDEDGDFVTIESDEDIQIAISEWREAQGSTPGGLGEIELFCV
GDVN
Download sequence
Identical sequences jgi|Thite1|136307|estExt_fgenesh2_pm.C_70122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]