SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thite1|71364|estExt_Genewise1Plus.C_30938 from Thielavia terrestris NRRL 8126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thite1|71364|estExt_Genewise1Plus.C_30938
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Pre-PUA domain 5.43e-29
Family Nip7p homolog, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 96-171
Classification Level Classification E-value
Superfamily PUA domain-like 3.87e-24
Family PUA domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Thite1|71364|estExt_Genewise1Plus.C_30938
Sequence length 183
Sequence
MRALTDQEMKTVLDKLANYMSDLKSLIAPLEDGDRYVFRLNHSRVYYVKLSIANLATSVS
RDALLSLGTCLGKMTKSGKFRLHITALPIIAAGARHKIWVKDNGAQPFLYGSNVVKAHVG
RWSEDCPEHSGCVIYNMADIPLGFGVTARSTAEARRLDPTGIVCFRQADCGEYLRDEDTL
FAG
Download sequence
Identical sequences G2RB42
XP_003655349.1.77082 jgi|Thite1|71364|estExt_Genewise1Plus.C_30938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]