SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thite1|71399|estExt_Genewise1Plus.C_30999 from Thielavia terrestris NRRL 8126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thite1|71399|estExt_Genewise1Plus.C_30999
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.77e-39
Family Calponin-homology domain, CH-domain 0.000029
Further Details:      
 
Domain Number 2 Region: 162-229
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000288
Family EB1 dimerisation domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Thite1|71399|estExt_Genewise1Plus.C_30999
Sequence length 242
Sequence
MGESRQELVQWLNSLLQLNITKVEQCGTGAAFCQVYDSIFLDVPMSRVKFNVNTEYAYIQ
NFKILQNTFTKHQIDRSIPVEALVKCKMQDNLEFLQWTKRFWDQHYPGGEYDAVGRRKGS
ALPPSRPTPRAPSGAARRPGGTTPTMGVSRAPVKPAGGAATAALQQENNTLKEMVVGLER
ERDFYFGKLRDIELLIQQLIEEDPELEKQEDGLVVQIQNILSATEEGFEIPEPEQYDDQE
TF
Download sequence
Identical sequences G2RB69
jgi|Thite1|71399|estExt_Genewise1Plus.C_30999 XP_003655376.1.77082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]