SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_05959 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TRV_05959
Domain Number - Region: 17-47
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0811
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRV_05959
Sequence length 1303
Comment | Trichophyton verrucosum HKI 0517 hypothetical protein (1304 aa)
Sequence
MGVPKFFRWLSERYPAISQLIAENRIPEFDCLYLDMNGIIHNCTHKDSDSPTFRMTEDKM
FIAIFNYIEHLFGKIKPKRLFFMAIDGVAPRAKMNQQRARRFRTALDAELAKEKAIKEGV
EMPKEDAFDSNCITPGTEFMAKLTKQLKYFINKKVSEDAEWQGVEVVLSGHEVPGEGEHK
IMEYIRQAKAQPEYDPNMRHCLYGLDADLIMLGLLSHDPHFCLLREEVTFGRQSQKKSKE
LEHQNFYLLHLCIVREYLELEFQELKLDGALQFPFDMERIIDDFILMAFFVGNDFLPNLP
NLHINEGALAWMFKVYKDVLPKLGGYVNEHGTINMERLRTLLAALSDVEFRFFEAEYSDA
RWLKSKTLDGDQTPTLPEKPNVLTITPAQKHIFNRIKKYVTHRPMDEAGQPVPLDLSPSL
PARDRKFVEQLADSLHLKWSSVLNQHEERFLRVQLPTNDDDDDEDDDDDESQIAILRVLK
KYENAKVKEVTAEDAQMAAEKKYEKKFQDWKDKYYKGKFGWGLENTEEMRKLTENYVQGL
QWVLFYYYRGVASWPWFYRYHYAPMISDIHLGLGADVDFKLGQPFFPFQQLMGVLPDRSK
KIVPVAFHSLMTSPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFIEEERLLKAMATKEH
LLTPDEKARNTFGVTLKFTYSPDVEFLYPSSLPGIFPDVSRCRCIENVFELPTMEGLDPY
VGLVEGVKIGAEALYGFPSLQTLQQTGQLGFHGVCVFQQESRNESMVVTISDPEIGGNTA
DAKTKLGKRVHVGYPFLQEAKVVCVSDELFDYVQVDGEEHVVPIPHTPTQISQWKKKAEK
IESYYSKRLGMVIGDVETIVRVEMLKGLKKTPDGATVKEFTEIPGVETEYAAQLIVDSVM
SEDLRFIEREAVPIEEEFPEGARAFFLGEYNYGAPVHVTGHEDGKLSGLLSAVKGKEPEF
GREHVLNAEKLSKYTPSFAIARNLRLSPLTLAKITSSFSVNMDGTRVNLGLNLKFEAKKL
KVLGYSRRGNSGWEFSERAIGLLQDYMIKFPDFIAGIQRKPQGDLFEPSDFYPADIAKEK
IKEIQAWLKSIESKSFERVPLEAEQLDSSIVQAIEKSADELSQSRPTPVAQKIRGVPRNA
LLKPADAEHRLNNQHFQLGDRVLYAQDSGKVPIASRGTVVGLTRTSRNLLLDVLFDVSFM
SGTTLSDRCSPFRGSTVPSSSVLNLTSKQLIALSRATAQNKEQAREQQLPLRAAAPQAMS
GMGQLKDEPTPPPLVNSYRGAATGQPSNGVTARRAAAVEEEAT
Download sequence
Identical sequences D4DFK8
XP_003019990.1.33076 TRV_05959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]