SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_06564 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_06564
Domain Number 1 Region: 82-281
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.1e-41
Family C-terminal domain of adrenodoxin reductase-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 10-139,316-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000117
Family C-terminal domain of adrenodoxin reductase-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRV_06564
Sequence length 471
Comment | Trichophyton verrucosum HKI 0517 hypothetical protein (472 aa)
Sequence
MGKVPEATIDMYEQLPVPFGLVRYGVAPDHPEVKNCQDKFTEVATSPRFNFIGNIELGGG
LPLNSLKPHYDAILFSYGASKDRELGLPNERSLSGIFSARAFVGWYNGLPEYRNLSPDLA
SGEDAVIIGQGNVALDVARVLLSDVDVLRKTDMSEHALEELATSRVKRVRVVGRRGPMQA
AFTIKEVRELMQLPSVGFEPIPSNLLPPDSIISGLPRANKRITQLLAKGSLTSLDSSAKK
WSLDFLLSPRSFHSSSEHPGRLSHITFSRNQLDPADPYSPSASISPHLADDGKVAHIDIS
ASLCFRSIGYKSCPLPGLDELAVPFDASRGLIPNDGQGRVLNTIPSASEADIIPTHVPGV
YCAGWVKRGPTGVIASTMTDAFATADAIAADWEVHRDRGSDNMEFLNSKSGKESTGLGWD
GVRPDAEKRGLRPTSWKDWEEIDRVEKERGQTRGKPREKFAQVNDMLGVLA
Download sequence
Identical sequences D4DHA8
XP_003019397.1.33076 TRV_06564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]