SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_02932 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_02932
Domain Number 1 Region: 286-428
Classification Level Classification E-value
Superfamily TPR-like 0.00000582
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRV_02932
Sequence length 453
Comment | Trichophyton verrucosum HKI 0517 TPR domain protein (454 aa)
Sequence
MTRSISSCRTAHRPRIQLLSRNPSISQSRSYTYYQRFRDNFRVAARNVHRKHPIGFPLTL
LFAVGNTALLVYIVYDFMTRVNPEFTKFPKEIATPLRKAVYYTEMDLNPPSALAYYKQAL
AAGYQLGLHPFSDEMLGIRLAVAAMLEKAKLFDAAIEVLTTIKHDCETWIDNGRRRKLIM
DRENQSGKNTRPDPSDFDAVAEHEAGLKKEQEEEELRDKVVKKIPGISLKLADIYSEQYP
DDTAKAEKFLTSAFETSRAELQRRRDLKLPITSDEENPAYLTLSEVGNACSELADHYVNK
GRSDLATILYMQAISLFKEDEGDGRHKCIQAVLLNNIASQMAEQAGKVPLGAALPSSASL
NPVSRDQLLSAAGEWAKKALDVASNVEESYKNEQCDQACVVALFNLGEIAEMQENSHQAE
DFYRKAKAAAVKVQFAEGTEQAEDALKRLRRKK
Download sequence
Identical sequences D4D753
TRV_02932 XP_003022945.1.33076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]