SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_03696 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_03696
Domain Number 1 Region: 102-164
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000157
Family EB1 dimerisation domain-like 0.00098
Further Details:      
 
Domain Number 2 Region: 7-57
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000656
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRV_03696
Sequence length 171
Comment | Trichophyton verrucosum HKI 0517 hypothetical protein (172 aa)
Sequence
MCFLYIGAFVRHQIDRPVPVQSLIKCRMQDNLEFLQWIKRHWDQYYPGGEYDAVARRKGS
GAPPPAAGGARSGTSSATGTRRGTTPTSAAGRARVGGANNLALTQELNAQKEAIAGLEKE
RDFYFAKLRDIELLLQQAVEADPELEKGDDSLVKHIQAILYSTEVLPLSMS
Download sequence
Identical sequences D4D9A5
TRV_03696 XP_003022172.1.33076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]