SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_03819 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_03819
Domain Number 1 Region: 634-748,781-828
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.69e-21
Family Calponin-homology domain, CH-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRV_03819
Sequence length 950
Comment | Trichophyton verrucosum HKI 0517 calmodulin-binding protein Sha1, putative (951 aa)
Sequence
MEYQYLDATPCPVTWKRNDAKIPIFEDILDSYDDTAEIDFMAELGSLNSLAREKPRRAKK
ATMFKIHEDSGSSGGSNGGQKPLYRESSMFSQPAQRFPRSAFKAPAGENSSPKVPVKKQQ
DDFKENSSGESPTSLKFPHGMQKPVKEQKMKKAGRTKRDKRRNTIYIPPDDDTTMATIFM
DAFSPLKTQDFGCQELGYIETQILKKRQQQKTTSPIRQRQPLEAPKRIMQELVDQPDVMG
KNTGKENVPPGKSESGIAEVTGKKDVLAEASTQPMKSRSVNSPRPRASLSKQKQSVSKSS
ASRATHSQSSARRTTLTSSRSPRTSPATKQRKEYLPLNTTLLINPISKRKSPSELLPTLL
LAPKIEIKHPALHANLADPLIHEETWLSHQEVVITQLVNTLLDTANGQCNTQGQDCLKQQ
LFDIYQDTYFSLLSKRVQASLLYGDLRVTEDSSGRRRRLTTDARIRRTFTKFWTDTYDIV
ALQTAAEVVIGREVGYNPHGGNISASPQIFISQDEKGTRRAVESFLDAMLIRNEDMSQDN
SSKSSVGDSSDVVKGYHRTALRSIMIIALLDKARMAPDTALPRSLFKPDSAYTSSTAAMR
ALGPVLLHPQTDFTRPLARLDCSLMYKQHPVAEYNYHIDNIAVDIRDGVILARLTELLLL
EHFPERFHAKDKEIWPLSGQLKMPCISRATKVHNARISLSALTKDFPSIGSTITGIKPED
IVDGYREKTIALLWVIVGKWGLSTLVDWDDLKSEIARLEKKLGRLSRKQSSLPPCHVQTT
TTDTAAYHSGLLHRWASCLARLKGLEVSNLTTSLADGHVFMSILDEYEHFIRPGSHGVKA
DKETSATASAPTKTPTSSTDNKSALRRRLLSLGCSSQFVLLSAAAQTSLSSCTHARTTTV
AASSEEASNLTALAFLSSRLLSASKYGRAAVTIQRAWRHMLATRPVIDLN
Download sequence
Identical sequences D4D9M6
TRV_03819 XP_003022078.1.33076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]