SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_04191 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_04191
Domain Number 1 Region: 22-95
Classification Level Classification E-value
Superfamily TPR-like 0.000000000228
Family HAT/Suf repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRV_04191
Sequence length 109
Comment | Trichophyton verrucosum HKI 0517 hypothetical protein (110 aa)
Sequence
MADLLFGGTDEENEELKKLYAEVLEDTDSFEAWEKLVRAAEGQEGGINRNSSPQAITATR
TVYDRFLAKFPLLFGYWKKYADLEFSIAGTEAAEMVSISHFMLSENRIC
Download sequence
Identical sequences D4DAP3
XP_003021680.1.33076 TRV_04191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]