SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_05023 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_05023
Domain Number 1 Region: 604-685,722-741,840-868
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000335
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRV_05023
Sequence length 966
Comment | Trichophyton verrucosum HKI 0517 hypothetical protein (967 aa)
Sequence
MAPSLPATYDTLFSPRAENAPRAAYDSLHPTEQDCIAILSHPFAQSITCHDAPGEQAKSV
ADDTSFAKLVSDRISALVNDPASRSRALYTAYAALYAFLQSNVTGPPLNGGAGINILPKL
GSASALREGMIRELSVDGEAVYKRIPVVELFVLAKSIFNHSAIVPEQIEHGDDILGLTGR
MRVNFMHQKMLGENADGLWADISADIERVARIVLDGPAGNADVSVGEKVRFMLERAVMYT
HHGLDGKAREDLLRAAGVNGFEFALTGKLGRRTKFQDRDISQLVVLARSKDTDTRDSSET
EKAKGGEAVEPKNLELNDDTLLESIAFKQDTTASVDVRDSSNLPASLASLDAANQPRLNP
LDSIILLSLASAITNTSPEDGLTREETIPYAVRVLEGGSSNWQVYSQALLVRSRIEGYRT
RTVERSVLQLQALVDQVIADTASDTPTPALSGETAEPSTQQPTTFLPRPEASESAPAAER
LQYIWLLNFSTRWNLESELAQRWVGLGALRTALDIYERLQMWAEAALCYAATDREETAKL
MVRKQLYQRTNPDSTGDDDTWQGAELSTLPPDAPRLFCILGDIDRDAAMYERAWTVSNKR
YARAQRSLARLYMQEKPPNLVKAEKAYKLSLAVTRLNHASWFAIGCIQLELEKWEDAIDS
FTRTVQLEETDAEAWSNLAVALLNAPPRTSTASALRDIPRPKPLDDEEEDEQESHEELDI
YKQKRDALAALHRAARFKHTDHRIWDNILTVGASIPPPSTPFRDVLLAQTRLIELRGEKD
GEKCLDIPVLTALVKTLTTPREGSSISIAYDPAAIRPGSIHAKLLRLFDENIIPLITHSP
ELWLLVADLEKWRGRPSQALAAHEKAWRATTASCAQGAYQMGEEDKWNDIVKATETLVRK
GYAVYGGMDKETEDGSKADEPELVAKDWRFKSRSAVRGILGKGKAFWDGTEGWSRLDTLL
KEVSGN
Download sequence
Identical sequences D4DD17
XP_003020885.1.33076 TRV_05023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]