SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_05338 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_05338
Domain Number 1 Region: 233-345
Classification Level Classification E-value
Superfamily TPR-like 0.0000217
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 
Weak hits

Sequence:  TRV_05338
Domain Number - Region: 319-419
Classification Level Classification E-value
Superfamily TPR-like 0.000133
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRV_05338
Sequence length 479
Comment | Trichophyton verrucosum HKI 0517 hypothetical protein (480 aa)
Sequence
MAQCSQNTASLNRHLKKVTLIAVSQVLGGYSRCVRLALVLFCFLGRDDISLALCARGATT
RKRWTDSGGIDETEADLDSGLALLLADSTALLPILRELQLDGAISIGPSNAFRMDPVYST
KILATLPLELRHLWRLKALLFASQTIPWEYLEPDFRPTDMSTEFAHLQHTLLEIKNNERY
RALDSNKKAEVISSLLEASRFTDVEGRLFAIANAKELMIGLKSRYLKYYVAHKESLALRL
TGDVAQAKEVLNSILPIASRYPSLRNVKTHWARGHILIQRALDYSQASELDKAIELLKGW
EAMSRHPSPIESTVLFRKHLLMGELLRYRGGFNESWSHLQRSERIIGIQPKLFFTQYRTD
LFFNIGSTLIELGDFAYAESQLRKELLRQAKEEDKAAPLLNLALAESIFAQKRYAEAQLI
CCEVACQAHISEREELHVLILFAKSSHTRSDWRQAYNYWHMAFLFSSSWKKYYRSLKIG
Download sequence
Identical sequences D4DDX4
XP_003020569.1.33076 TRV_05338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]