SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TRV_07979 from Trichophyton verrucosum HKI 0517

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRV_07979
Domain Number 1 Region: 147-236,347-586
Classification Level Classification E-value
Superfamily TPR-like 3.41e-35
Family Tetratricopeptide repeat (TPR) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRV_07979
Sequence length 632
Comment | Trichophyton verrucosum HKI 0517 hypothetical protein (633 aa)
Sequence
MAPIQPVVPSLPSSTIQQHIENTAASSSPSVWDRISSWASENKALVYTIAGVAVVVTSAG
VVYYLSDTGRPTQVSGQSGEKRKSKKERRKEKKAEQEKKAATSEKSEPKAATEQAPEELP
DVDESNVDSLPAQTRERYAGILKAAGNKAFGSKDYNRAIELYGKAILCKPDPVYYSNRAA
CYNALGEWEKVVEDTTAALAMDDEYIKAMNRRANAYDKLGKYSEALLDYTASCILDGFAS
DTGKAAVERLLKQVAEEKGRAILEGKGKKLPSATFVSNYLQSFRPKPVPEELDESVELKE
DSGLGQLRKGLLAVAKSTGDGYDEAARAFEKALELGELGKLEALALNMRATFTYLAGEAA
AALTDLNKSIELDPSLVQSYIKRASLYLETGNRESAQDDFDLAVTQNKDDPDIYYHRAQL
HFILGELGEAAKDYQKSIDLDRDFIYSHIQLGVTQYKLGSVASAMATFKRTLKNFENVAE
VYNYYGELLLDMQKFSEAIEKFDRAVELEKSNKPWSINVLPLINKALAIFQWKQDFQEAE
NLCQKALIIDPDCDIAIATLAQLLLQQGKVSQALKYFERAAELARTEAEVINAVSYAEAT
RAQLEVQEKYPKLAARLAQMGGAAGLGAPGGF
Download sequence
Identical sequences D4DLA5
TRV_07979 XP_003018016.1.33076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]