SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512591315|ref|YP_008099157.1| from Lactobacillus reuteri I5007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512591315|ref|YP_008099157.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-48
Family Protein kinases, catalytic subunit 0.0000838
Further Details:      
 
Weak hits

Sequence:  gi|512591315|ref|YP_008099157.1|
Domain Number - Region: 374-434
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00101
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 238-286
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512591315|ref|YP_008099157.1|
Sequence length 520
Comment protein kinase [Lactobacillus reuteri I5007]
Sequence
MEQVLSAVATAHAHGIIHRDLKPQNILIDENKNVKITDFGIAVAVSQDSLTQTNTLMGSV
HYLSPEQARGSIATKQSDIYSLGIILFELLTGKVPFEGETAVSIALKHFREEIPSVREQN
KEIPQALENVIIKATAKEPAERYSSVNEMAADLKTVLDPQRANEPRLKIQQDDNGETKVL
DIKHLKADDYQSKKSNDSPTVDPSTKPQKWKKYGIVSGTLGMIVLIAVCSWWFLIRQVII
PDVEGMTVQKAEQRLHQQNLRIGKITRVNSQAVDKNRIVSTNPDVSHKTRVSTPINLIVS
TGVKQLQMADYVGDDYSSVAANLRRKGFQVHQEPVYSDDIDKGQIIRQNHKKGTIVKPAA
NTIIFRVSAGKEPIKIPNFKNQDISAVQQFANKNNLQLTTQEKKSKTIATNHVINQTPRA
GSTLNHGDTLTVSIANSGNQTKTTNIQINIPFDGNGGQRENRVQVYIRDANHNLTMEYQD
ITINQETTINVPFTLKQGQTGAYRVVRNGRTIMSATNITG
Download sequence
Identical sequences R9WIZ7
gi|512591315|ref|YP_008099157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]