SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512591835|ref|YP_008099677.1| from Lactobacillus reuteri I5007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512591835|ref|YP_008099677.1|
Domain Number 1 Region: 207-601
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.24e-83
Family beta-Lactamase/D-ala carboxypeptidase 0.0000023
Further Details:      
 
Domain Number 2 Region: 64-255
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.94e-43
Family Penicillin binding protein dimerisation domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 603-658
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000000968
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0036
Further Details:      
 
Domain Number 4 Region: 661-714
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|512591835|ref|YP_008099677.1|
Sequence length 719
Comment cell division protein FtsI/penicillin-binding protein 2 [Lactobacillus reuteri I5007]
Sequence
MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAINKDVQHVNLRSQAEQI
YTQQRIIQARRGDIYDSEGNPLATDTSRYTLYAVLDRTQKSSDGKPLYVKNRQKTAKILS
QYIDLTPKQIEKTLKPKGQAYQVEFGSAGSNLSVSTMQKIKNRHLPGINFIATPARQYPE
GEFASQIIGMATPKIKNDNGTEETNLVGQLGLEGYFNKQLTGTNGLRKDKQDVYGYQIAN
SKQVTKKAINGDNIYTTLDSQTQHFLENKVNKVYKSSNANAMTAVVMEAKTGKIIAATQR
PTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHFNPNATFNSGTWAMGGGKITD
WSSSGWGTISYKDAFDMSSNVGFAHVEQDMGADTWMKYIKRFGLLKKVNVIGMSNEVNGY
TSFKGILAQANTAFGQGITVNVMQMMQAFSAIGNNGKMMKPYIVSKVVDGNSGKTIQKIK
PKVVGHPIKASTAKKVLGYMQGVVYDQKGLGHDYQIKGYRVAGKTATAQIGGAHGYSTGD
TNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKPATKQIASVFNPTMKMLLSQQKVAEKAK
KKVITMPNVVGQSSDDANKKLSDKGMQVIVVGSGKKVKQQSAVPDEQVLTDQHVILDTGG
EYKMPDISGWSSADVQQLAKVLKLKVKENGNGYVTQQSISPDTTIKRGTTLTVQYEAKN
Download sequence
Identical sequences F8KCC7 R9WKG1
gi|512591835|ref|YP_008099677.1| WP_003674435.1.15136 WP_003674435.1.22145 WP_003674435.1.29664 WP_003674435.1.37338 WP_003674435.1.42007 WP_003674435.1.43790 WP_003674435.1.50790 WP_003674435.1.51589 WP_003674435.1.56673 WP_003674435.1.64205 WP_003674435.1.66136 WP_003674435.1.81220 WP_003674435.1.92923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]