SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|510880379|ref|YP_008053047.1| from Salinarchaeum sp. Harcht-Bsk1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|510880379|ref|YP_008053047.1|
Domain Number 1 Region: 20-183
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-19
Family GHMP Kinase, N-terminal domain 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|510880379|ref|YP_008053047.1|
Domain Number - Region: 243-276
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00331
Family Homoserine kinase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|510880379|ref|YP_008053047.1|
Sequence length 293
Comment shikimate kinase [Salinarchaeum sp. Harcht-Bsk1]
Sequence
MDGRARAPGAGTVLNALATGRGSAFAIEAYTTASVSLDTELEVVTGEIAGAPDADTALIE
RCVELVVERFGDGEGGAVRTESDVPMAAGLKSSSAAANATVLATLDALGVADEDPTLVET
GAIDRADACRIGVQAARDVGVTVTGAFDDASASMLGGVTVTDNTEDDLLAREERDWDVLV
YTPDEQAFTADADVDRCERIAATADLVAEHALEGDFARAMTVNGFAFSAALEFPTEPMIE
ALPHAEGVSLSGTGPSVVAVGERTELEAVEAIWQERPGTTRLTTTQIEGATIQ
Download sequence
Identical sequences R4W827
gi|510880379|ref|YP_008053047.1| WP_020445143.1.31664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]