SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|510880404|ref|YP_008053072.1| from Salinarchaeum sp. Harcht-Bsk1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|510880404|ref|YP_008053072.1|
Domain Number 1 Region: 7-61,200-401
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.59e-41
Family Bacterial dinuclear zinc exopeptidases 0.0091
Further Details:      
 
Domain Number 2 Region: 81-194
Classification Level Classification E-value
Superfamily PA domain 0.00000000000017
Family PA domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|510880404|ref|YP_008053072.1|
Sequence length 433
Comment peptidase M28 [Salinarchaeum sp. Harcht-Bsk1]
Sequence
MTNWIGEAFTSDAGWNHLETLVDVGDRMAGSEGEREAAAATRDALAEVGARDAHLESFDV
QGWTRGTSELRAGDTSQECIALPRSPSGEATGELIDVGYGLPSDFEQDLEGAVVMAASNV
PGWYDRFLHRREKYYHAVEAGAAAFVFRNHVEGCLAPTGSVGTEDDPIGDVPAIGVSKEV
GDRLLRRWEGDSVTVDVEAEISDATSRNVHATLGPDTDEEVLLTSHVDAHDIAEGAGDNG
AGTAVVVEAAKALAAREDELDTKVHLLVYGAEEVGLCGSAYDSDQRDHDDIKAIVNSDGV
VRGRTLRCYTHDFDELEAAAETVADRFDHPIETTPKLNPHSDHWPYVQWGVPGFHLMSET
DYEGRGWGHTRADTLDKLEQRTLREQSILIADLVDHLADSDTTIEHRTPESIAAQLEDDD
LAEGMKVIGDWPY
Download sequence
Identical sequences R4W836
gi|510880404|ref|YP_008053072.1| WP_020445168.1.31664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]